KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_2306Help
Entry
YPDSF_2306        CDS       T00505                                 

Definition
(GenBank) phosphoserine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp00260  Glycine, serine and threonine metabolism
ypp00680  Methane metabolism
ypp00750  Vitamin B6 metabolism
ypp01100  Metabolic pathways
ypp01120  Microbial metabolism in diverse environments
ypp01130  Biosynthesis of antibiotics
ypp01200  Carbon metabolism
ypp01230  Biosynthesis of amino acids
Module
ypp_M00020  Serine biosynthesis, glycerate-3P => serine
ypp_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    YPDSF_2306
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPDSF_2306
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YPDSF_2306
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ypp01007]
    YPDSF_2306
Enzymes [BR:ypp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     YPDSF_2306
Amino acid related enzymes [BR:ypp01007]
 Aminotransferase (transaminase)
  Class V
   YPDSF_2306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABP40681
UniProt: A4TN19
Structure
PDB: 

Position
complement(2624487..2625572)
Genome map
AA seq 361 aa AA seqDB search
MTQVYNFSAGPAMLPVEVLRRAEQELRNWHGLGTSVMEISHRSKEFMQVAEESEKDLRDL
LQIPANYKVLFCHGGARAQFAAVPLNLLGDRNSADYIDGGYWAHSAIKEAQKYCTPNVID
VTTHDNGLTGIQPMKQWKLSDNAAYVHYCPNETIDGVAINEQPDFGNKVVVADYSSSILS
RPIDISRYGVIYAGAQKNIGPAGLTLVIVREDLLGKAHTALPSILDYKVLADNDSMFNTP
PTFAWYLSGLVFKWLKEQGGLCEMEKRNQAKAELLYGAIDRTGFYRNQVAITNRSWMNVP
FQMADASLDKLFLREAEAQGLQALKGHRVAGGMRASIYNAMPIEGVKALTDFMADFERRH
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggtttataattttagcgctggtccagcaatgttaccggtcgaagtattacgt
cgtgcagaacaagaattacgtaactggcatggtttgggaacgtcggtgatggaaattagt
caccgcagtaaagaatttatgcaggttgctgaagagtcggagaaagatctgcgtgacctg
ttgcagataccggctaattataaagtgttattttgccatggtggtgcccgagcacagttt
gctgcggtgccattgaacttgcttggtgaccgcaacagcgctgactatatcgatggtggc
tattgggcgcacagtgcgattaaagaagcacaaaaatactgcactcctaatgttattgat
gtcaccacccatgacaatggcttaacaggtattcagccaatgaagcaatggaagttgagc
gataatgcggcctatgtgcactattgcccaaatgaaaccattgacggcgttgcgattaat
gaacagcctgatttcggcaataaagttgttgttgccgattactcctcatccattctttcc
cgtcctatcgatattagccgttatggtgtgatctatgctggcgcacagaagaacattggc
ccagcgggcttgacactggttatcgtgcgtgaagatttacttgggaaagcccacacggcg
ttgccgtcgatcctggactacaaggtattggcagataacgattcgatgttcaatacaccg
ccaacgttcgcttggtatctttctggcctggtatttaaatggctgaaagagcagggtggt
ttgtgcgaaatggaaaagcgcaatcaggcgaaagctgaactattgtacggtgccatcgac
cgcacaggcttctatcgcaatcaggttgctattactaaccgctcttggatgaatgtgccg
ttccaaatggcagatgcttcattagataaactgttcttgagagaagctgaagcacaaggt
ctgcaggccttaaaaggccaccgtgttgccgggggcatgcgggcttctatctataacgct
atgccaattgaaggcgtaaaagccttaaccgactttatggctgattttgaacgccgccat
ggctga

DBGET integrated database retrieval system