KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_2831Help
Entry
YPDSF_2831        CDS       T00505                                 

Definition
(GenBank) Gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp00430  Taurine and hypotaurine metabolism
ypp00460  Cyanoamino acid metabolism
ypp00480  Glutathione metabolism
ypp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    YPDSF_2831
   00460 Cyanoamino acid metabolism
    YPDSF_2831
   00480 Glutathione metabolism
    YPDSF_2831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ypp01002]
    YPDSF_2831
Enzymes [BR:ypp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     YPDSF_2831
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     YPDSF_2831
Peptidases and inhibitors [BR:ypp01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   YPDSF_2831
CD molecules [BR:ypp04090]
 Proteins
  YPDSF_2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ABP41193
Position
3204371..3205672
Genome map
AA seq 433 aa AA seqDB search
MAPAIRLARDGFILTCADTDILDTTVKRFRQDPESARIFLRKDGEALQPGDRLVQADLAD
TLSAISEKGPDAFYQGKIPQAVEAAAKKGGGILTAADFADYKITETAPITCSYRGYKFVS
APPPSSGGVTLCETLNVLEGYNLKSMGFNSADYIHTLTEAMRHAYMDRNTFLGDPEFVKN
PLDRLLSKSYAADIRKQIVANKATPSVEVQPGMQPHEKPETTHYSIVDHEGNAVSTTYTV
NGRFGAVVIAPGTGFFLNNEMDDFTVKVGEQNLYGLVQGATNAIAPGKRPLSSMSPTLVT
KDGKTFMVLGSPGGSRIISITLQTALNVIDHGMAPQEAVDAPRIHHQWLPDEVYYEQRGV
SADSLNILKSMGYKMVEQSPWGAAELILVGLAGVEGVSPANSGNDSAVSGKVREGYLYGA
NDVRRPAGAAIGY
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcaccggctatccgtttggcccgtgacggctttatcctgacttgcgccgataccgat
attctggacaccaccgtcaaacgtttccgtcaggatcctgagtctgcacgtatcttcctg
cgtaaagatggagaggcactacaaccgggcgatcgtctggttcaggccgatctcgcggat
acgttaagcgcgatttcagaaaaagggccggatgcgttctatcaaggtaaaataccgcaa
gctgtggaagcagcggctaaaaagggaggcggaatactgactgccgccgatttcgccgat
tataaaatcaccgaaaccgcaccgattacctgtagttatcgcggttataaattcgtttca
gccccaccgccgagttccggtggcgtcacattatgtgaaacgctaaatgttttggagggc
tataacctcaaaagtatgggctttaactccgctgactatatccatacgctaacggaggca
atgcgccatgcctatatggaccgcaataccttcctcggtgatccagagtttgttaaaaat
ccgcttgaccgcctactgagcaaaagctatgccgccgatatccgtaaacagatcgtcgcc
aacaaagcaacaccatcagtagaagtacaaccgggtatgcaacctcacgaaaaaccggag
acgacacactactccatcgtcgatcatgagggtaatgccgtttctaccacgtataccgtt
aatgggcgctttggcgcggtggtcattgctcctggtactggcttcttcctcaataatgaa
atggatgattttacagttaaagtgggtgaacaaaatctgtatggattggtacaaggtgca
accaacgctatcgcccccggtaagcgcccactatcgtcaatgagcccgacactagtgacc
aaagatggaaaaacatttatggtcttgggttcaccgggtggctcacggattatcagcatc
acgctgcaaaccgccctgaacgtcattgaccacggtatggccccgcaagaagcggttgat
gcaccacgtattcaccatcagtggctacccgatgaagtctattatgagcaacgcggtgtc
tcagcggacagcctcaatatcctgaagagtatgggatataagatggttgaacagagccct
tggggcgcagcggagttgattttagtcggcctggccggtgttgagggcgtcagcccggct
aactcgggtaatgattctgctgtctccggcaaagtccgtgagggctacctgtacggtgcc
aatgatgtccgtcgccccgcaggggctgctattggctactaa

DBGET integrated database retrieval system