KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_3121
Entry
YPDSF_3121        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_3121
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_3121
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ABP41479
Position
complement(3549265..3550620)
AA seq 451 aa
MLPKQRVAWVEGMLMEPQHFQQQERYLEHLTEMRARSLSALAWGFHSLSINQGLLDQGKI
ALNQASGVFPDGTPFHMAGDEPLPLPFDPGENCQGSVVCLSVLMDIPGNTYIDLKKSNQG
SRFVALDAEVQDRNHGVAAEGTPLIATLQLGQLQSKLTLRASVSDAESMLPVAYIKERTR
DGRLILDDNFLPPMLDFRAIGWIDNAVTELLGLIVQRLESVYRPDVTLSVGGLSELLELL
LLQTLSEYNLKISHVLMQKQVHPEQLFQLLLGLLGRLSTIPGGEKPWSRQDLLYTHHEPH
NGYFSLFAALRRALSLVIEAPAVALPFIERGDNIYLCQNDSQLRLEKLIFTVSSKLPSET
IRTYFPAQTKLGPVEKIVQLIDLQLPGARMIPMSSPPRYIPYYPNSVYFEVDHDDPMYKE
MMSGSAIALSIVGDFPELRFEVWGLRQGRLG
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgctgccaaaacaacgtgttgcttgggtggaagggatgctgatggaaccccagcatttt
caacaacaggaacgatatctagaacatttaactgaaatgcgggcacgtagcctcagcgcg
ctggcatggggcttccatagcctaagtatcaatcaagggctgctggatcagggcaagatc
gccctcaatcaggccagtggtgttttccctgacggtacaccttttcatatggcgggtgat
gagccattaccgctaccttttgatccgggggagaactgccaaggcagtgtcgtgtgcctt
tcggtcctgatggatatacccggcaatacctatattgatctgaagaagagcaaccaaggt
agccgtttcgttgcgctggatgctgaagttcaagacagaaaccatggcgtcgctgctgaa
ggaacgccattgatcgccacccttcaactggggcaattgcaatccaagctcaccttacgt
gccagcgtcagtgatgcagaatcgatgctgcccgtagcctatatcaaagagcgcacccgc
gatgggcgtctgattctggatgataacttcctgccacccatgttggattttcgcgccata
gggtggatcgataatgcggtaaccgaattgctagggttgatcgttcagcgactggaatcg
gtttaccggccagatgtgacgctctcagtcggtgggttatcggagttactggaactgcta
ttactgcaaacactcagtgaatataacctaaagatttcacatgtgttgatgcaaaaacag
gtacaccctgagcagttgttccaattattgcttgggttgttggggcgtctcagtactatc
cctggcggagaaaaaccgtggtcgaggcaggatctgctctatacgcatcatgaaccgcac
aacgggtatttctcgctgtttgccgccttacggcgcgcactctcactggtgatcgaagca
ccggcagtggcgctaccgtttatcgaacgtggcgacaatatttacctgtgccagaacgat
tcacaactgcgtctggaaaaactgatcttcaccgtcagttccaaactgccttccgagacc
attcgcacttacttcccggcgcaaaccaaactggggccggtggagaaaattgtacagttg
atcgacctgcaattgcctggcgcacggatgatcccgatgtcatcaccgccaagatatatt
ccttattacccgaatagcgtctatttcgaagttgaccatgatgatcctatgtataaagaa
atgatgtctggttcagctatcgcactcagcatcgtgggtgatttccctgagttgcgtttt
gaagtatggggcttgcgacaaggaaggctcggatga

DBGET integrated database retrieval system