KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_3122
Entry
YPDSF_3122        CDS       T00505                                 

Definition
(GenBank) lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPDSF_3122
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_3122
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_3122
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ABP41480
Position
complement(3550740..3551231)
AA seq 163 aa
MRSLFRVLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPGPNGQAQPLK
VCIIELNKEGWSPPGLYQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWA
IAAEFQEMSNGKSLLTLKSDARADFNRVVLVDGKALSLKASTK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcgtagcctctttcgtgtgttgcctatttttatcctgacaggttgcgtcctgctcagc
ggctgtagctggttttcctcatcctcagaagcggcgctacagaaacggcggattgacttg
caggttgttgcggctcctctcatcaatcctgggcccaacggtcaggcacagcccttgaag
gtatgcattattgagctgaataaagaggggtggtcaccccccggtttgtatcaggggacg
ctctgcagtggcatcagtgtaggaggtgaagtcgtcagcgtgacggaatacatccttgcg
ccgacagaggtgcgtcaatattcccgcgatgttccctttgaacaagagcgctggtgggca
atagcggctgagtttcaggagatgagtaacggtaaaagcctattaacgctgaaatctgat
gcccgtgcggacttcaaccgtgtggtgctcgttgatggtaaggccctgtcattaaaagcg
tcaacaaagtag

DBGET integrated database retrieval system