KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_3128
Entry
YPDSF_3128        CDS       T00505                                 

Definition
(GenBank) Clp ATPase
  KO
K11907  type VI secretion system protein VasG
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPDSF_3128
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_3128
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_3128
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_16 AAA_5 Clp_N AAA_22 Sigma54_activat Zeta_toxin AAA_7 NACHT ResIII T2SSE ClpB_D2-small Torsin AAA_30 AAA_18 Lipase_chap TniB DUF87 AAA_25 RuvB_N DUF815 RsgA_GTPase ATPase_2 TrwB_AAD_bind IstB_IS21 Muted SseB_C FlxA
Other DBs
NCBI-ProteinID: ABP41486
Position
complement(3558018..3560606)
AA seq 862 aa
MYQRERLFNRLGTFAYKTFVEATRLCRSYRHEYVELEHWLKILMDQQRGDIPALLTHYGL
SQTVISTQLDRIIQHMPVTKASVQDLSSRLESVVEGGLVLSQLMASPSPIRTSHILLALL
QDTQHQRWLYRLCDEFKKLPVPQVAEEYEGLLVNSIEQTSEVQRGDALVTETDSSSSKEA
HAALNKWCNDLTQQARDGEIDPVIGREAELRQVIDILLRRRQNNPILVGEAGVGKTAVVE
ALARKLASGDVPPLLQGARLLSLDLGRMQAGASMRGEFESRLKSLIDGISQSDTPVILFC
DEAHTLVGAGGQAGTGDAVNLLKPMLARGALRMIAATTWSEYKQFIEPDAALTRRFQRVL
IGEPNESTAVDMLRAIAPHFAQHHNVTIRDGAIHAAVRLSLRNLPSRQLPDKAISLLDTA
CARVALSQYAQPQAIEQLSAQLDVLKTEHQYLVREKQLGEAVDQRLDDVQTQIQAFEHEL
TALQSRHLHEQQLVREVLPEGEGSGMMTENARWGELMALQEASPLVYPWVDEQSIAAVLS
DWTGIPSGKMLQDDIECVLNLEQRLGDHIFGQRNAIKEISQAIRIARAGIQSQERPLGIF
LLAGSTGTGKTETANVLVETLYGGAHNLITFNMSEFQEAHTLSTLKGAPPGYVGYGKGGK
LTEAVRRKPYSVILLDEFDKAHADIQDAFYQVFDKGWMEDAEGRRVSFRQCFILLTCNQG
AEEIEQAYLTANDIKPGALKPLVYDALLRRFAPALLARVNIIPYIPLDQDALAQIASHHL
ARLQTRLWDEIGATLVTEGDIPGWIASRVCSHPNHGRAVEELLRQTLLPAVGNEVLKRRH
EAEPLREIRLIVEETELSIEFA
NT seq 2589 nt   +upstreamnt  +downstreamnt
gtgtatcaacgcgaacgtctttttaatcgattgggcacttttgcctataaaacttttgtt
gaagccacccgtctttgccgcagttatcggcatgagtatgtggagcttgaacattggtta
aaaattctcatggatcaacagcgtggggatattcctgctctactgacgcattacggactg
agccagacggttatctccacgcaattggatcgcattattcagcatatgcccgtcaccaaa
gcatcggtgcaggatttatcatcacgcttggagtccgtggtcgaaggcggattggtgttg
agccaattgatggcgtcaccttctcctatccgtacctcgcatattttactggcactatta
caggatacccagcatcagcgctggttataccgcctgtgcgatgaattcaaaaagctgccg
gtcccacaggttgcagaggaatatgaaggcctattagttaactccattgaacagaccagc
gaggttcaaagaggcgacgcattagtgacggaaacggacagcagctcatcaaaagaagcg
catgcggcattgaacaaatggtgtaacgaccttacccagcaagcccgtgacggtgagatt
gaccccgttattggtcgtgaagcagaactgcgtcaagtgattgatattttactccgtcgc
cgtcagaacaaccctattttggttggggaagcgggggtcggtaaaacggcggtggttgaa
gcgctagcgcgaaaactggccagtggcgatgtccctccgctgttgcaaggggcgcgtctg
ctttctctggatttggggaggatgcaagccggtgccagtatgcgcggtgaatttgaatca
cgtcttaaatccctgatcgatggcatcagccaatcggataccccggttattctgttttgt
gatgaagcccatacgttggtgggggcaggcgggcaggcgggcacgggggatgcggtcaac
ctgcttaaaccgatgttggcgaggggcgcattgcgcatgatcgccgccaccacctggtca
gagtataaacagtttattgaacctgacgccgcgctgacccggcgtttccagcgggtattg
attggcgagccaaacgaatctaccgccgtcgatatgctacgggcgattgcgccacatttt
gctcaacatcataacgtcactatccgcgacggtgccattcacgcggcggtgcgcctgtca
ttacgcaacctgccttcccggcagttgcccgataaagccatcagtctgctcgacaccgct
tgcgcgcgggtcgcgctcagccaatatgcccaaccacaggcgattgaacagttatcggcc
caactggatgtgctcaaaaccgagcatcaatatctggtacgggagaagcaactgggcgaa
gcggttgatcaacggctagatgacgttcagacacagatccaggcgtttgaacatgaacta
accgccttgcaaagccgccatctgcatgagcaacagctagtgagggaggtcctgccggag
ggagaaggcagtggcatgatgacggaaaatgcccgctggggtgaactgatggcgttacag
gaagcgtcgccactggtctatccatgggttgatgagcagagcatcgccgcggtgctttcc
gattggaccgggatcccgtccggcaaaatgttgcaggacgatattgaatgcgtcctgaat
cttgaacagcgtctcggtgatcatattttcgggcaacgcaacgctatcaaagagatttcg
caggcgatacgtattgctcgggcgggcatccagtctcaggagcggccactcgggatcttc
ctgctggcggggtcaaccggtacgggcaaaacagaaacggccaatgtactggtcgaaacc
ttgtatggcggtgctcataaccttattaccttcaatatgagtgagttccaagaggcgcat
accttatccacgctgaaaggcgcacctccgggctatgtcggctatggcaagggggggaaa
ttaaccgaagcggtaagacgcaaaccttattcggtcatcctgcttgatgagtttgataaa
gctcacgccgatattcaggacgccttttatcaggtcttcgacaaagggtggatggaagat
gccgaagggcgtcgggtcagtttccgccagtgtttcatcttactgacctgtaatcagggc
gcggaagagatcgaacaggcttacctcaccgccaacgatatcaaacccggtgcattaaaa
ccgttggtatacgacgccctgttgcgccgctttgcgccagcgctgttagccagggtcaat
atcattccttatatcccattagatcaggacgctctggcacagatcgcctctcatcatctt
gcgcgcttacaaacgcgcctgtgggatgaaattggtgccactttggtgaccgagggggat
atccccggctggatcgcctcacgggtttgcagccatccgaaccatggtcgtgcggtggaa
gaactcttgcgtcaaaccttacttcccgctgttggcaatgaagtgttgaagcgtcgccat
gaggctgaaccgctgagagagatacgcctgattgttgaggagacagaactgagtattgag
ttcgcgtag

DBGET integrated database retrieval system