KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_3129
Entry
YPDSF_3129        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_3129
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_3129
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABP41487
Position
complement(3560624..3561607)
AA seq 327 aa
MASLQTLKNTFLPGISASQDFFELLRRIERATPEQGRLGTQRDRSHLRLRIIQPADMGFA
PREVSDIRQTLNTHQHLAEITIFCRHFGLFAPYGPLPIHVTEHARNEALAKRNQAFEHFA
GILSQRMAILHYRSWAQMHVAVGHDRASANPFMNHVRQIAGLTPQQALNSHVDRVRRCFP
GVYLPGRGSLRKLQEILSLYFSVPIRVEARKGLWIDDSRNIESQRMGRLGNTRIGSRFFD
VQHSLVLSIGPVSDPQYLDFQRNSKRINTLVQICHDFVRHRMVLDVQLIIQTSPNMACRL
GGGTLSRHSWLKPGSALSIQPIYRTVT
NT seq 984 nt   +upstreamnt  +downstreamnt
atggctagcctccagacgctgaaaaacacgtttctgccgggtatctcggccagtcaggac
tttttcgagttgctgcgtcgcattgagcgtgccactccagagcaaggccggcttggcacc
caacgtgatcgtagccatctgcggctacgtattattcagcctgccgatatgggatttgca
ccgcgtgaagtgagtgatatcaggcaaacgctgaacactcatcagcatctggcagagatc
accattttctgccgccattttggtttatttgccccgtatggcccgttgccaatacatgtt
accgaacatgctcgtaacgaagcgttggctaaacgtaatcaggcctttgaacattttgcg
ggcattctcagccagcgaatggcgatcttgcattatcgctcttgggcccaaatgcacgtc
gccgtggggcatgatcgcgcgtcagccaatccctttatgaaccatgtgcgtcaaatcgcg
ggcctaacgccgcagcaagcgctgaattcacatgtggatcgggtacggcgttgctttccg
ggggtgtatctgccgggcagaggatcattacgcaaattacaggagatcctgagcctgtat
ttctcggttcctatccgtgttgaagcccgtaaaggattgtggattgacgactcgcgcaat
atagaaagccaacgtatgggacggttgggtaacacgcgtattggcagccgtttcttcgat
gtgcagcacagcctggtgttatctattggtccggtatctgacccccaatatctggatttt
caacgcaacagcaaacgcattaacactctggtgcaaatctgccatgactttgtccgccat
cggatggtgctggacgtgcaattaatcatacagacctcacccaatatggcttgtcgtctt
ggcggtggaacgctcagtcgccatagctggttaaagccaggctcagccttgagtatacag
ccaatttatagaacggttacctag

DBGET integrated database retrieval system