KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_3132
Entry
YPDSF_3132        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPDSF_3132
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_3132
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_3132
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABP41490
Position
complement(3563994..3564512)
AA seq 172 aa
MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLGGGGGSGKVEMKDFEF
RMVSNKASPKLFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFSNCLVSSFKTVGNMPLG
KGDAVFTDTVLPTDAISLNFARIEVEYKEQQPDGSMGAVIKAGYDLKLNSRI
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcagctttagtcgattactttctccatatcgaaggtgtagatggtgagtctcccgat
cagcagtataacggatggatccaagtacaggcttggcaatgggcggaggagaatgcgggg
cgctgggggctaggtggcggtggtggttctgggaaagtcgaaatgaaggacttcgaattt
cgcatggtgagtaacaaagcatcaccaaaactatttttgatgtgtgccatcggtgaacac
attccgcaggccaagttggtgtgtcgtaaatcaggtcaaggtcaacaagacttcctgatt
gttaccttcagtaactgtctggtgtcctcctttaaaactgtcggcaacatgcctcttggt
aaaggggacgcagtattcaccgacacggtgctgccaacggatgccatcagccttaacttt
gcacgtatcgaagtggaatacaaagagcagcaacctgatggctcgatgggggccgtgatt
aaggctggttacgatctgaaattgaacagccgtatttaa

DBGET integrated database retrieval system