KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_3133Help
Entry
YPDSF_3133        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_3133
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_3133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: ABP41491
Position
complement(3564675..3566186)
Genome map
AA seq 503 aa AA seqDB search
MENMQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIGTLAAYANKGQVK
VNRDVVLTIESLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRV
LNISQDELGKTLRRYRGSAWDQSPIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVAL
LTELAKVAAAAHCPFITSSSPSIMQMNNWRELGNPRDIGKIFTTPEYAPWRRLRESNDSR
YLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFTWANAAYAMGVNINRAFNEYG
WCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRRENELSNAGFLPLVYRKN
SDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSR
DDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQ
LEGMTVSLRLVSKLPSNKESEKK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtggagaacatgcagaaagcccaactcaatgacacgccagacatcaacgtcgatctggct
gaaaacgagttagatgacattttaaaacgttcttttcgccctcgaactgacgaagcttcc
gccacagtgcgccgtgccataggcacgcttgctgcgtatgccaataaaggccaagtgaaa
gtcaatcgtgatgtcgtactgaccattgagtctttagtcgctgaaattgacgaaaaactt
tccgatcaaatgaaccttattctgcaccataaagagttccaaaagctggaatcagcttgg
cgcgggcttagctatcttgttgataatacagatgctaatgaaactttaaaaatacgggta
ctgaacattagccaagatgaactggggaaaacgcttcgccgttatcgtggctctgcatgg
gatcaaagtccgatatttaaacaggtctatgaacatgaatatgggcagtttggtggggaa
ccttttggttgcatgatcggtgattatgaattcgatcacagtccacagagtgtggctctg
ctgaccgagttagccaaggtggccgccgccgctcactgtcctttcattacctcttcttcc
ccaagcatcatgcagatgaataactggagggagctgggtaacccaagggatatcggcaaa
atctttaccacacctgaatatgcgccatggagacgtttacgtgagagtaatgactcccgc
tatctggtactgactctgccacgttttctttcgcgtctgccgtatggtgccaaaaatcat
cctattgatgattttgcttttgaagaagtggttagccctcatgccagtgaggatttcacc
tgggcgaatgcggcctatgccatgggcgtcaatattaaccgggccttcaatgaatatggt
tggtgttcaaggatccgcggtattgagtcgggggggtccgtagaagaacttccggcctat
gcttttccttctgacgaaggcggatatgaactcacttgtccgacagaattggcaatttcg
gaccgtcgtgagaacgagctatccaatgctgggtttttaccgctggtctaccgtaagaac
tcagactttgccgcctttatcgggtcgtgcaccctgcatgcaccggcaaactatgatgac
cccgatgcgacggcgaacgccagattatcggcccgtttaccttacatttttgccacctgt
cgtttcgcccattacctcaaatgtattgtgcgcgacaaaattggttcgttccgctcgcgg
gatgacatgcaactttggcttaacgactgggtgatgaactacgtcgatggtgacccctcc
atttcaacagaagccactaaagctaaacgcccgctggccgctgcggaagttcaagttgaa
gacgtagaggatgatcctggtttttaccgcgctcacttctatttacgccctcactaccaa
cttgaaggtatgacggtttctctgcggctggtttctaaacttccatccaacaaggaaagc
gaaaagaaataa

DBGET integrated database retrieval system