KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_3622Help
Entry
YPDSF_3622        CDS       T00505                                 

Definition
(GenBank) 60 kDa chaperonin
  KO
K04077  chaperonin GroEL
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YPDSF_3622
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ypp03019]
    YPDSF_3622
   03110 Chaperones and folding catalysts [BR:ypp03110]
    YPDSF_3622
   03029 Mitochondrial biogenesis [BR:ypp03029]
    YPDSF_3622
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypp04147]
    YPDSF_3622
Messenger RNA biogenesis [BR:ypp03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     YPDSF_3622
Chaperones and folding catalysts [BR:ypp03110]
 Heat shock proteins
  HSP60 / Chaperonin
   YPDSF_3622
Mitochondrial biogenesis [BR:ypp03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    YPDSF_3622
Exosome [BR:ypp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YPDSF_3622
  Exosomal proteins of other body fluids (saliva and urine)
   YPDSF_3622
  Exosomal proteins of breast cancer cells
   YPDSF_3622
  Exosomal proteins of colorectal cancer cells
   YPDSF_3622
  Exosomal proteins of bladder cancer cells
   YPDSF_3622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-ProteinID: ABP41972
UniProt: A4TRR0
Position
complement(4160860..4162506)
Genome map
AA seq 548 aa AA seqDB search
MAAKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREI
ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGI
DKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIAQAMEKVGKEGVITVEEG
SGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESPFILLADKKISNIREMLPVLEAV
AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTAGTV
ISEEIGLELEKTTLEDLGQAKRVVINKDTTIIIDGVGDEAAIQGRVAQIRQQIEDATSDY
DKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALI
RAAHAIAGLKGDNEDQNVGIKVALRAMESPLRQIVVNAGEEASVIANKVKAGEGSFGYNA
YTEEYGDMIAMGILDPTKVTRSALQYAASIAGLMITTECMVTDLPRDDKGADMGAGGMGG
MGGMGGMM
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaaagacgtaaaattcggtaacgacgctcgcattaaaatgctacgcggcgta
aacatccttgctgatgcagtgaaagtgactctgggccctaaaggccgtaacgtagttctg
gataagtctttcggttctccaacgatcactaaagacggtgtttctgttgcacgtgaaatc
gaactggaagacaagttcgagaacatgggcgcacagatggttaaagaagttgcctctaaa
gcaaatgatgctgcgggtgacggtaccacgactgcaacagtattggctcaatccatcatc
actgaaggcctgaaagcagttgccgcaggcatgaacccaatggatctgaagcgcggcatc
gacaaagccgttatcgcagcggtagaagagctgaaaaaactgtctgtaccttgctctgat
tccaaagcgattgctcaggtcggtaccatctctgcaaactccgactcaaccgttggcgaa
ctgatcgctcaagcgatggaaaaagtcggtaaagaaggcgttatcaccgttgaagaaggt
tcaggcctgcaagacgagttggacgttgtagaaggtatgcagttcgatcgcggctacctg
tctccttacttcatcaataaaccagaaactggctctattgaacttgaaagcccattcatt
ctgttggctgacaagaaaatctctaacatccgtgaaatgctgccagttctggaagccgta
gcgaaagccggcaagccactgctgatcattgcagaagacgttgaaggcgaagccctggcg
actctggtagtgaacaccatgcgcggtatcgttaaagttgcagcggttaaagcacctggc
ttcggcgaccgtcgtaaagcgatgctgcaagacatcgcgaccctgactgcgggtactgtt
atctctgaagagatcggtctggaactggaaaaaactactctggaagatctgggtcaggcg
aaacgtgttgttatcaacaaagacaccaccatcattattgatggcgtaggcgatgaagcg
gcaatccaaggccgtgtggctcagattcgtcagcagattgaagatgccacttctgactac
gacaaagaaaaactgcaagagcgtgttgctaaactggctggcggcgttgccgttatcaaa
gtgggcgccgcaactgaagttgaaatgaaagagaagaaagcacgcgttgaagatgctctg
catgcaactcgtgccgcagtagaagaaggcgtcgtagcgggtggtggtgttgcactgatt
cgtgcagctcacgctatcgctggcctgaaaggcgataacgaagaccagaacgtgggtatt
aaagtggctctgcgtgcgatggaatctccactgcgtcagatcgtggttaacgcgggtgaa
gaagcctctgttatcgcgaacaaagttaaagcgggtgaaggtagcttcggttacaacgct
tatactgaagaatacggcgacatgatcgcgatgggtatcttggatccaactaaagtgacg
cgttctgctctgcagtacgcagcctctattgctggtctgatgattaccaccgagtgcatg
gttactgacctgccacgtgatgacaaaggtgctgatatgggcgctggcggcatgggtggt
atgggtggtatgggcggcatgatgtaa

DBGET integrated database retrieval system