KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_4109
Entry
YPDSF_4109        CDS       T00505                                 
Name
(GenBank) conjugative transfer assembly protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_4109
Secretion system [BR:ypp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   YPDSF_4109
SSDB
Motif
Pfam: TraF
Other DBs
NCBI-ProteinID: ABP42446
Position
MT:complement(88951..89700)
AA seq 249 aa
MKKRKTALALLLLGSVFSATGKDAGWQWYNESHRTPEDDKSSSAQPQQASPDIMEKLATL
QQATKRAMYEAILYPGVENFTRYFRLQNYWTQQAGLFSMSAKKAMLEHPELDYNLQHSHY
NGTVRNQLAADFADQRLAIETLAQRYGVMFFYRGQDPIDGQLVQVIKNFRETYHLSVIPV
SVDGIVNPLLPDTRMDGGQASRLGIRYFPALMLADPKSGTVKPVSYGFISQDDLAKQFLN
VSTDFAPNF
NT seq 750 nt   +upstreamnt  +downstreamnt
gtgaaaaagagaaagacagcgttagcgctgctgcttcttggcagcgttttttccgccaca
ggaaaagatgccggctggcagtggtacaacgaatcgcacagaacgccggaggacgacaaa
tcctcttcagcacagcctcagcaggcctcgccggacatcatggagaagcttgccacgctt
cagcaggccacgaagcgcgccatgtacgaggccattctgtatccgggcgtggagaacttt
acccgttacttccgcctgcagaactactggacgcagcaggccgggctgttctcgatgagt
gctaaaaaggcgatgctcgagcaccccgaactggactacaacctgcagcacagccactac
aacggtaccgtgcgcaaccagctggcggcggactttgccgaccagcgcctcgccattgaa
acgctggcacagcgctatggcgtgatgttcttctaccgcggacaggacccgatcgacggc
cagctggttcaggtcattaaaaacttccgcgagacgtatcacctcagcgtcattccggtc
tctgtggacggtatcgtgaatccactcctgccggatacccgaatggacggtggacaggcc
agccggctgggtattcgttacttcccggcgctgatgctggccgaccctaaaagcgggacg
gtcaaacccgtctcgtatggctttatcagccaggatgacctggcgaagcagttcctcaac
gtttccacagattttgcccccaacttttaa

DBGET integrated database retrieval system