KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_4118
Entry
YPDSF_4118        CDS       T00505                                 
Name
(GenBank) conjugative transfer assembly protein
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_4118
Secretion system [BR:ypp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   YPDSF_4118
SSDB
Motif
Pfam: TrbI TMF_DNA_bd MbeD_MobD ATG16 EzrA Lebercilin
Other DBs
NCBI-ProteinID: ABP42455
Position
MT:complement(99085..100479)
AA seq 464 aa
MASINSVVKRKQFIWLGIVLATVGVVGGGGWYLADARYEGSSDSAAAGEPAPDMTGVVDS
TFDQKVQQHATTEMQATASEMQKQYAEMRRELELLSKGQAGYQHQIDKLSQDNSALSAQV
SALGAKPVTSSGEPAPQPPVPAPGPEGEPQPTGFPPQTGAVPPPTAFYPGNGVTPPAQVQ
YQPIPVPNQLRRQSFARSDESKGPSLPYIPSGSFAKSMLIEGADANASVTGNESTVPMQL
RITGRVEMPNSKSYDLTGCFIGLEAWGDVSSERAIVRTRNISCLKHGVTIDQPIAGHVSF
RGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGVQTASQPSVGLGATASLGAGDVMKMGI
GGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTIEELAHENDRSKAE
GSDRSPVPPPSVPQGGMNGFSTDQMLNQLGRLNQSQFMPKADSQ
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggccagcattaattcagtggtgaagcgcaagcagtttatctggctgggtatcgtgctg
gcgaccgtgggcgtggtgggcggcggcggctggtatctggcggatgcacgctacgagggc
agcagcgattcggcagccgccggcgagcctgcgcccgatatgaccggcgtggtggacagc
acctttgaccagaaggtgcagcagcatgccacgaccgagatgcaggctacggcctccgag
atgcagaagcagtatgccgaaatgcgccgcgagcttgagctgctcagcaaggggcaggca
ggctatcagcaccagattgacaaactcagtcaggataattcggcgctttccgctcaggtc
agcgcgctgggggcgaaacccgtcacctcatcgggcgagcctgccccgcagccgccagtg
cctgcgccggggcctgaaggtgagccgcagccgaccggtttcccgccgcagacgggggcc
gtcccgccgccgaccgcgttctatccgggtaacggcgtcacgccgccggcgcaggtacag
taccagcccattcccgtacccaaccagctgcgccggcagtcttttgcccgcagcgacgag
agcaaaggtccgtccctgccgtacatcccgtcgggcagcttcgccaaatcgatgctgatt
gagggggctgatgccaacgcctccgtaaccggtaacgagtccacggtgccgatgcagctg
cgcattacgggcagggtggaaatgcccaacagcaaaagctacgacctgaccggctgcttc
attgggcttgaggcctggggcgacgtgtccagcgaacgcgccatcgtacgcacccgcaac
atcagctgcctgaagcacggcgtcaccatcgaccagcccattgccggacacgtgagcttc
cggggtaaaaacggcatcaagggcgaagtggtgatgcgaaacggcaaaatcctcggctgg
gcatggggtgcgggttttgttgacggcatcggtcagggggtgcagaccgcgtcccagcct
tcggtcggactcggcgccacggcatccctcggcgcgggtgacgtgatgaagatggggatt
ggcggaggcgcctccaaagccgcccagaccctcagcgactactacatcaaacgcgcagag
cagtaccaccccgtcattcctattggggcgggtaacgaagtgaccgttgtctttcaggac
ggttttcagctgaaaaccattgaagagctggcgcacgagaatgacagaagcaaagcggag
ggcagcgaccgcagtccggttccgccgccgtcagtcccgcagggcggcatgaacgggttc
agtaccgaccagatgctcaaccagctgggcaggcttaaccagagccagtttatgccgaag
gccgactcacaataa

DBGET integrated database retrieval system