KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_4122
Entry
YPDSF_4122        CDS       T00505                                 

Definition
(GenBank) conjugative transfer fimbrial subunit
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
SSDB
Motif
Pfam: TraA Fig1
Other DBs
NCBI-ProteinID: ABP42459
Position
MT:complement(102233..102583)
AA seq 116 aa
MTDVSIINAVPATPAKKKFSKVALLKALKFALPVAALAAFFPETVLASTAGKDLMSSGDA
TVKGTFGKDSSVVKWVILAEVLVGAVMYMTTKNLKFLAGFAILSVFVTVGMSVAGY
NT seq 351 nt   +upstreamnt  +downstreamnt
atgactgatgtgtctattattaacgctgtacccgcgacccctgcaaagaaaaaattcagc
aaagtcgcgttactcaaagcgctgaagtttgccctgcctgtcgcagcccttgctgcgttt
ttccctgaaacggttctggcctcgactgcgggtaaagatctgatgtccagcggcgatgca
accgttaaaggtacatttggtaaagattccagcgtggttaagtgggttattcttgccgaa
gtcctggtaggggccgtgatgtatatgacgaccaagaacctcaagttcctggcgggcttt
gcgatcctgtccgtattcgtcacggtaggtatgtctgtcgcaggatactga

DBGET integrated database retrieval system