KEGG   Yersinia pseudotuberculosis ATCC 6904: DJ40_2401Help
Entry
DJ40_2401         CDS       T03307                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
ypq  Yersinia pseudotuberculosis ATCC 6904
Pathway
ypq00860  Porphyrin and chlorophyll metabolism
ypq01100  Metabolic pathways
ypq01110  Biosynthesis of secondary metabolites
Module
ypq_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ypq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DJ40_2401 (hemN)
Enzymes [BR:ypq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     DJ40_2401 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AIN13671
UniProt: A0A3G5ITP5
Position
complement(2652301..2653674)
Genome map
AA seq 457 aa AA seqDB search
MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAVKRYPQRPLSLYVHIP
FCHKLCYFCGCNKLVTRQQHKADEYLVVLEKEIRQRAALFTGRQVSQMHWGGGTPTYLNK
TQISHLMTVLREHFDFLPDAEQSIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQR
LVNREQDEDFIFALIARAKALGFNSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVF
NYAHLPSLFAAQRKIKDADLPTAEQRLDILQHTIRFLTESGYQFIGMDHFARPDDELAIA
QQEGTLHRNFQGYTTQGESDLLGLGVSAISMLGDSYAQNEKDLETYYACVEQRGNALWRG
LTMTEDDCLRRDVIKTLICHFQLSYQPIEQRYGIRFADYFAEDFELLAPFEQDGLVERNE
TGLRVTPRGRLLIRNICMCFDIYLRKQARKQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcacgctatagtttgggatctatccctgattcaaaaatataattattcaggg
ccgcgttatacctcgtatccaacggctcttgagtttagtgaagattacaatgagtctgct
ttccagcaggcggtgaaacgttatccgcaacggccattgtcgctgtatgtgcatattccg
ttttgccacaaactttgctacttctgtggctgcaataaactggtgacgcgtcagcaacat
aaagctgatgaatatctggtggtgttggaaaaagagatccgccagcgggctgccttattt
accgggcgtcaggtcagccagatgcactggggggggggtacgccaacctatctgaataaa
acgcaaatcagccatttaatgacggtgctgcgtgaacactttgattttctgcccgatgcg
gagcagtcaatcgaagttgacccccgtgaaattgaattagatgtgcttgatcacctgcgt
gctgaagggtttaatcgcctgagcatgggggtgcaggatttcaataaagaggtgcagcgg
ctggttaaccgcgagcaagatgaagattttatcttcgctttaattgcccgagctaaagcg
cttggatttaactcaaccaatattgatttgatttatggcttgcccaagcagacaccagaa
agttttgctttcaccttaaaacgggttgctgagctgaacccagatcgcttaagcgtgttt
aattacgcccatctgccaagcctgtttgccgcccaacgtaaaatcaaagacgctgatctg
ccaacggcggagcaacggttggatattttgcagcacaccatccgtttcttaacggagtct
ggctatcaattcattgggatggatcattttgcgcgtccggatgatgaactggcaattgct
cagcaggaaggaacattacaccgcaactttcaagggtataccacgcagggtgagagcgat
ctccttgggttgggggtttctgctatcagcatgttaggtgacagctacgctcagaatgaa
aaagatctggaaacatattacgcctgtgtagagcaacggggtaatgcgttgtggcgcggc
ctgactatgaccgaagacgattgtttacgccgagatgtgattaaaacgctgatttgtcat
ttccaactcagttaccagccgattgagcagcgttatggtattcggtttgccgattatttt
gccgaagattttgagctgcttgcaccttttgaacaggatgggctggtggagcgaaatgaa
acagggcttcgcgtgaccccccgtgggcgcttactcattcgtaatatttgtatgtgtttc
gatatctatttacgtaaacaggcgcgcaagcagcaattctcacgtgtaatctga

DBGET integrated database retrieval system