KEGG   Yersinia pseudotuberculosis ATCC 6904: DJ40_76Help
Entry
DJ40_76           CDS       T03307                                 

Gene name
rstB
Definition
(GenBank) sensor protein rstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
ypq  Yersinia pseudotuberculosis ATCC 6904
Pathway
ypq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DJ40_76 (rstB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypq01001]
    DJ40_76 (rstB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypq02022]
    DJ40_76 (rstB)
Enzymes [BR:ypq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DJ40_76 (rstB)
Protein kinases [BR:ypq01001]
 Histidine kinases
  OmpR family
   DJ40_76 (rstB)
Two-component system [BR:ypq02022]
 OmpR family
  RstB-RstA
   DJ40_76 (rstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AIN15422
UniProt: A0A0T9J6G7
Position
complement(82843..84147)
Genome map
AA seq 434 aa AA seqDB search
MRKLFIQFFLLLFVCFMVMAMLVGLVYKVTAERAGRQSLDDLMKSSLSLMRSELREIPLK
DWNKTIATLDLNLSFQLHIEPLDKRDLGAQLNKRLRAGEIIALDDEYTFLQRIPRSHYVL
AVGPVPYLFYLHQMRLLDLALLILIGLSLALPVFLWMRPHWKDLLKLENAAQRLGSGHLD
ERTHFDPTSSLSRLGVAFNQMADNINTLIVSKKLLIDGIAHELRTPLVRLRYRLAMSDNL
TESEQQALHHDIGQLEALIDELLTYARLDRPQVSLNLEPIDLPAWLTTKIMDIRSIHQER
EIELDIPHRGDFGAVDLRLMERVLDNLVNNALRYSHQRLRIGLWFDGDNACLQVEDDGPG
IPPEERTRIFEPFVRLDPSRDRATGGCGLGLAIVHSIALAYQGSISVNTSPLGGASFRFS
WPIKTHLPLSADQN
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagctatttattcagttttttttgttgttattcgtttgcttcatggtgatggcg
atgctggttggcctggtttataaggtcaccgctgagcgcgcgggtcgtcagtctttagat
gacctgatgaaaagttcactatcactgatgcgcagcgaattgcgggagatcccgctaaaa
gactggaataaaaccatcgcaacattagatttaaatctttcttttcaacttcatatcgaa
ccattagataaacgtgatcttggcgcacaattgaacaaacggctacgtgcgggtgaaatt
attgcattggatgatgaatataccttcctgcaacgtatccctcgtagccactatgttctg
gcggttggcccggtcccttatctattttatttacaccagatgaggctgctcgatttagca
ttattaatcttgattggcctgtcgttagctcttccggtatttctctggatgagaccgcac
tggaaagatcttctcaaattagaaaatgccgctcagagactgggctcaggccaccttgac
gagcggactcatttcgaccccacttccagtctaagccgtttaggcgtggcttttaaccaa
atggctgacaacatcaacaccctgattgttagcaaaaaattactgattgatggtatagca
cacgaactacggacaccattggtacgcttacgttatcgattagcgatgagtgataacctg
accgaaagcgaacagcaggcgttacatcatgatatcggtcaattggaagcacttattgat
gaactactgacctatgcacgtttggatcgcccacaagtttccctcaatctggaacctatc
gacctaccggcctggctaacaaccaaaatcatggatatccgctcgattcatcaagagcgt
gagatcgaacttgatattccccaccgtggtgattttggtgccgttgacctgcgtctgatg
gagcgagtgctggataacctggtcaataatgccctacgctattcacatcaacggctgcgc
atagggttatggttcgatggcgataacgcctgcctacaggttgaagatgacggccccggt
atcccgccagaagaacggacacgaatttttgaaccctttgttcgtttagaccccagccgt
gatcgtgccactggtggctgtggattggggctggccattgtccattcgattgcactggcc
tatcaaggcagtatctctgtcaataccagtccattaggtggggccagtttccgctttagt
tggccgataaaaacacatttgcctctatccgctgatcagaattaa

DBGET integrated database retrieval system