KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_1463Help
Entry
BZ20_1463         CDS       T03678                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BZ20_1463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AJJ05720
Position
1649887..1650264
Genome map
AA seq 125 aa AA seqDB search
MIEQPRICVQVQSIYVETQSIPEEERFVFAYTVTVRNLGRSNVQLLGRYWLITNSNGHQT
EVQGEGVIGEQPLILPGNEFQYTSGAVLETPLGTMEGHYEMIDHLGQAFRTVIPVFRLAI
PALIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagccccgtatttgtgtgcaggtacaaagtatctatgtggaaacgcaatcg
atacccgaagaggagcgtttcgtcttcgcctataccgttactgttcgtaatttagggcgt
tcaaacgtgcaactgcttggccgctattggttaattaccaatagcaatggccaccagact
gaagttcagggagaaggggttatcggcgaacaaccacttatcctgccaggtaatgaattt
caatacaccagcggtgccgttctggaaaccccgctgggtactatggaaggacattatgaa
atgattgatcaccttggacaggccttccgtactgtaattccggtattccgcttagcgatc
ccagccctgatccattaa

DBGET integrated database retrieval system