KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_1510Help
Entry
BZ20_1510         CDS       T03678                                 

Gene name
nadR
Definition
(GenBank) trifunctional NAD biosynthesis/regulator protein NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Pathway
ypr00760  Nicotinate and nicotinamide metabolism
ypr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BZ20_1510 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ypr03000]
    BZ20_1510 (nadR)
Enzymes [BR:ypr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     BZ20_1510 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     BZ20_1510 (nadR)
Transcription factors [BR:ypr03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    BZ20_1510 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_19 HTH_31 HTH_26 CTP_transf_like Citrate_ly_lig MMR_HSR1 HTH_37 AAA_16 FAD_syn HTH_35 ABC_tran AAA_29 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AJJ06717
UniProt: A0A3G5KI16
Position
complement(1704882..1706153)
Genome map
AA seq 423 aa AA seqDB search
MLQFDYLKTAIKQKGCTLQQVAEASGMTKGYLSQLLNDKIKSPSAQKLEALHRFLGLEFP
RREKKVGVVFGKFYPLHTGHIYLIQRACSQVDELHVILCHDEPRDRELFENSSMSQQPTV
SDRLRWLLQTFKYQKNIHIHSFDEHGIEPYPHGWDVWSRGVKAFMNEKGIVPSFIYSSES
QDAPRYREQLGIETILIDPQRSFMNISGRQIRRDPFRYWDYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGREYVFSHLGGDEMALQYSDYDKIALGQAQYVDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SDRDRKSFQNLLEQMLRDNNIEYVHVESADYDARFLRCVELVQQLLAADPQRLARPSVLT
DAR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagttcgactatctcaaaacagcaattaagcaaaaaggctgcaccttacagcag
gtggctgaggccagcggcatgaccaaaggctatttaagccagctacttaacgataaaatc
aaaagccccagtgcgcaaaaattagaggccttacaccgttttctcgggttggaattcccg
cgccgtgagaaaaaagtcggtgtagtgtttggtaaattttaccctctgcataccggtcat
atttatcttatccagcgcgcctgtagccaggtcgatgaactgcacgtcattctttgccac
gatgagccgcgtgatagggagttgtttgagaacagttcgatgtcgcaacaacccacggtc
agtgaccgcctacgttggttgttacaaacctttaaatatcagaaaaatatccacattcac
tcttttgatgagcacgggattgagccttatcctcacggttgggatgtgtggagccgtggc
gtaaaagctttcatgaatgaaaagggtattgtccccagctttatctattccagcgagagt
caggatgcgccgcgttaccgggagcaactgggaattgaaaccattttgattgacccgcag
cgctcatttatgaacatcagtggccgccagatccgccgcgatcctttccgctattgggat
tatatcccgactgaagtcaaacccttctttgtgcgcacggtagccatcctcggtggcgaa
tccagtggtaaatcgacgctggttaacaagttagccaatatcttcaataccaccagtgcg
tgggaatatggccgtgagtatgtcttctcccatctggggggcgatgagatggcactgcaa
tattcggactatgacaaaattgcgctggggcaggcgcagtatgtggattttgctgtgaaa
tacgccaataaagtggcgtttattgatactgatttcgtcaccacacaggcattttgtaag
aaatatgaagggcgggaacaccccttcgttcaggctctgattgatgaataccgttttgat
ctggtgatcttattggaaaataataccccgtgggtggcagatgggttgcgtagcctcggt
agtgaccgcgatcgaaaatccttccaaaatttactcgagcagatgttgcgcgacaataat
attgaatacgttcatgtcgagtcagccgattatgacgcccgcttcctacgctgcgtcgaa
ctggttcagcaactgctggccgccgatccgcaacggcttgcccgcccttcagtattaacg
gatgcgcgataa

DBGET integrated database retrieval system