KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_2095Help
Entry
BZ20_2095         CDS       T03678                                 

Definition
(GenBank) HAD hydrolase, IA, variant 3 family protein
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Pathway
ypr00010  Glycolysis / Gluconeogenesis
ypr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BZ20_2095
Enzymes [BR:ypr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     BZ20_2095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Acid_PPase SHOCT HAD Hydrolase_like Urocanase
Motif
Other DBs
NCBI-ProteinID: AJJ08869
UniProt: A0A3G5ITH2
Position
complement(2356071..2356661)
Genome map
AA seq 196 aa AA seqDB search
MLYIFDLGNVIVDIDFKRVLGVWSKLSSVPLATLNERFTMGEVFQQHERGEISDEDFAHQ
LSDEMGISLSFEQFAEGWQAIFVALRPEVIDIMNKLRREGNRVVVLSNTNRLHCYYWPEH
YPEVAAAADHMYLSQDLGMRKPEARIYQHVLNAENVPAEQAVFFDDVEANVLAAKAVGIN
AIHVTDRQIIPTYFSL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatctagggaatgtgattgttgatatcgacttcaaacgtgtttta
ggtgtttggagcaaattaagcagtgttccgttggctacattgaacgagcgttttacgatg
ggagaggtatttcagcaacatgagcgtggtgaaatcagcgacgaggattttgcccaccag
ctcagtgatgaaatggggatatccttgagtttcgagcagttcgctgagggttggcaggcg
atattcgtcgctttgcggccagaagttattgatataatgaataaattgcgtcgtgaaggg
aatcgtgttgttgtgttatcgaataccaaccgcttacattgttattactggccagagcac
tatcctgaagtcgctgctgctgctgatcacatgtatttgtcacaggatttgggaatgcgt
aaaccggaggccagaatttatcagcatgtactgaatgctgaaaatgtaccggcagagcag
gccgtgttctttgacgatgtcgaagcgaatgtactcgccgccaaggctgttggtataaat
gctattcacgtcaccgatagacaaattattcctacttatttttccttataa

DBGET integrated database retrieval system