KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_2402Help
Entry
BZ20_2402         CDS       T03678                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Pathway
ypr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BZ20_2402 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ypr03011]
    BZ20_2402 (rplV)
Ribosome [BR:ypr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BZ20_2402 (rplV)
  Bacteria
    BZ20_2402 (rplV)
  Archaea
    BZ20_2402 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733
Motif
Other DBs
NCBI-ProteinID: AJJ06221
UniProt: A0A0T9M7B5
Position
2725310..2725642
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacatcgccacgctcgttcttctgctcagaaggttcgcttggta
gcggacctgattcgcggtaagaaagtgtcgcaagctctggaaactctaacctacaccaac
aaaaaagctgctggtttggttaagaaggtactagagtctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagtcacgaagatcttcgtagacgaaggccct
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system