KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_494Help
Entry
BZ20_494          CDS       T03678                                 

Definition
(GenBank) 3-Oxoacyl-[acyl-carrier-(ACP)] synthase III family protein
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Pathway
ypr00280  Valine, leucine and isoleucine degradation
ypr00650  Butanoate metabolism
ypr00900  Terpenoid backbone biosynthesis
ypr01100  Metabolic pathways
ypr01110  Biosynthesis of secondary metabolites
ypr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BZ20_494
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BZ20_494
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BZ20_494
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BZ20_494
Enzymes [BR:ypr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     BZ20_494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III Chal_sti_synt_N CP12
Motif
Other DBs
NCBI-ProteinID: AJJ06046
Position
complement(550511..551749)
Genome map
AA seq 412 aa AA seqDB search
MNSIGIEKISIYPSSLALKLSELAQARGGDNKYIQESLMVIKRSLVPQWEDAVTLAVNSA
KDMLNDQDRSDIGLFIIATESGLDQEKAISTWAHRYLGLPATCRVFELKSACHAGAAALK
MAESWISSGLNRGKKVLLINVDISNNMICHGKMEYSLGAGAIALLISDNPVFAVIETGKS
GIHTHEVTDVIRPLPWKEVAFDVEASLFSYMDGLENAFEEYCHQTPEARESTYFNYNLYH
VPFPGISKEAHKVLLELQGLFGKEALATSFKQKVMPSLYYAQKIGATYCGSIFLSLFSLM
VKAPEIKSGDRIGVYSYGSGSCAEYFSMQVGDQAVEIAQQQGAALDILLTQRKILDVAAY
EQLENARSAQMQGKDYRLDGDNLQDWYTHHYSGSGLLILERIDNHLRRYRYA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtattggtattgaaaaaatcagtatctacccaagtagtttggcgctgaaatta
tctgaattggcacaagcacgtggtggggacaataaatacattcaagaatctttaatggtc
ataaagcgcagtttggtaccacagtgggaagatgcggtcacccttgccgtcaatagtgcc
aaggatatgcttaacgatcaggatcgttcggatatcggtttatttatcattgcaacagaa
tcaggtttagaccaagaaaaggccatcagtacttgggcgcatcgttatttaggattacct
gcgacttgccgtgtttttgaactgaaatctgcctgccatgctggtgctgcggcattaaag
atggctgagtcatggatatcgtccggccttaatcgagggaaaaaggtattactgatcaac
gtggatatcagtaataatatgatttgccacgggaagatggaatatagccttggtgctggg
gccattgctttacttatctcagataatcccgtttttgccgttattgaaacagggaaatcg
ggtattcatactcatgaagtgacggatgttattcgcccacttccctggaaagaggtcgct
ttcgatgtagaagccagccttttctcttatatggatggactcgagaatgctttcgaggaa
tattgtcatcagacaccggaggccagagaaagtacctatttcaattataacttataccat
gtccctttccctggcattagtaaagaagcacataaagtattattagaactacaaggactc
tttggaaaagaggcgctagccacttcatttaagcaaaaagtcatgccatccctgtattac
gcgcaaaaaataggcgcgacctattgtggcagcattttcctttccctattttcacttatg
gtgaaagcaccagagattaaatcaggggatcgaataggggtctactcttatggttcagga
tcctgtgccgagtatttcagcatgcaggtcggggaccaggcagtagagattgcacaacag
caaggtgcagcgttggacatactgcttacccagcggaaaatactggatgtggcggcatac
gagcaactggaaaatgcacgtagcgcacaaatgcaaggtaaagactatcgtttagacggg
gacaacttacaggactggtatacacaccattacagcgggagtgggctccttattcttgag
cgtatcgataaccacttacggcgttatcgctatgcatga

DBGET integrated database retrieval system