KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_596Help
Entry
BZ20_596          CDS       T03678                                 

Gene name
ltaE
Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Pathway
ypr00260  Glycine, serine and threonine metabolism
ypr01100  Metabolic pathways
ypr01110  Biosynthesis of secondary metabolites
ypr01120  Microbial metabolism in diverse environments
ypr01130  Biosynthesis of antibiotics
ypr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BZ20_596 (ltaE)
Enzymes [BR:ypr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BZ20_596 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AJJ08891
Position
679166..680185
Genome map
AA seq 339 aa AA seqDB search
MLIDLRSDTVTQPCAAMRAAMANAEVGDDVYGDDPTVNALETKAASLSGKEAALFLPTGT
QANLVALLTHCQRGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDNVLAA
IKPDDIHFAPTRLLSLENTHNGKVLPLRYLQQAWALTREKKLALHIDGARVFNAAVALNV
PLNDISQYCDTLTICLSKGLGTPVGSLLCGSAEFIHRARRWRKMTGGGMRQAGILAAAGL
YALQHNVARLKDDHDNAQWLEQQLRDLGIEIAAPGAQTNVLYITQSAESALKLGPWMRER
GVLISAGPLTRLITHLNVSRKDLEKVVALWREFIAEQHS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgatttacgcagtgacacagtaacgcaaccctgtgccgccatgcgcgccgcg
atggcgaatgccgaggtcggcgatgatgtgtatggcgatgacccaaccgtcaatgcgctt
gaaaccaaagccgccagtttatccggtaaagaagccgcgctgtttctgccaacaggcact
caggcaaatttggtggcgctattgacccattgtcagcgtggtgaagagtatattgtcggc
caaaaagcccataactatttgtatgaagccgggggtgccgccgttttgggcagtatccaa
ccacaacctattgatgccaacgatgacggcacactaccactggataacgttctggccgcc
atcaaacccgatgacattcactttgcccccacccggctgttaagtttggaaaatactcac
aatggcaaagtcttgcctttgcgttatttacagcaagcctgggcgttgacccgcgaaaaa
aaactggcgttacatattgatggcgcacgtgtttttaatgctgcggtggcgctgaatgtg
ccactgaacgatattagtcagtattgcgataccctgacaatttgtctgtcaaaagggtta
gggacgcctgttggttccctgctctgtggcagcgcagaattcattcatcgcgcccggcgc
tggcgaaaaatgaccggtggtggtatgcgtcaggccggtattttagcggcagccgggttg
tatgcgctgcaacataatgtggcgagactcaaagatgatcacgataacgcccagtggttg
gaacagcaattacgtgacttaggcattgagatagccgcccccggcgcgcaaacaaacgtg
ctgtacattacgcaatctgccgaatcagcgttgaaacttggcccctggatgcgtgaacgt
ggtgtgctgatcagtgccgggccgctcacccgcctgattactcaccttaacgtgagccga
aaagatctggaaaaagtcgtcgcgctgtggcgtgaatttattgccgagcaacattcatga

DBGET integrated database retrieval system