KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB0588Help
Entry
YPTB0588          CDS       T00195                                 

Gene name
nadR
Definition
(GenBank) transcriptional regulator NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00760  Nicotinate and nicotinamide metabolism
yps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yps00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YPTB0588 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:yps03000]
    YPTB0588 (nadR)
Enzymes [BR:yps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     YPTB0588 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     YPTB0588 (nadR)
Transcription factors [BR:yps03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    YPTB0588 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_19 HTH_31 HTH_26 CTP_transf_like Citrate_ly_lig MMR_HSR1 HTH_37 AAA_16 FAD_syn HTH_35 ABC_tran AAA_29 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: CAH19828
UniProt: Q66EV3
Position
692626..693897
Genome map
AA seq 423 aa AA seqDB search
MLQFDYLKTAIKQKGCTLQQVAEASGMTKGYLSQLLNDKIKSPSAQKLEALHRFLGLEFP
RREKKVGVVFGKFYPLHTGHIYLIQRACSQVDELHVILCHDEPRDRELFENSSMSQQPTV
SDRLRWLLQTFKYQKNIHIHSFDEHGIEPYPHGWDVWSRGVKAFMNEKGIVPSFIYSSES
QDAPRYREQLGIETILIDPQRSFMNISGRQIRRDPFRYWDYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGREYVFSHLGGDEMALQYSDYDKIALGQAQYVDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SDRDRKSFQNLLEQMLRDNNIEYVHVESADYDARFLRCVELVQQLLAADPQRLARPSVLT
DAR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagttcgactatctcaaaacggcaattaagcaaaaaggctgcaccttacagcag
gtggctgaggccagcggcatgaccaaaggctatttaagccagctacttaacgataaaatc
aaaagccccagtgcgcaaaaattagaggccttacaccgttttctcgggttggaattcccg
cgccgtgagaaaaaagtcggtgtagtgtttggtaaattttaccctctgcataccggtcat
atttatcttatccagcgcgcctgtagccaggtcgatgaactgcacgtcattctttgccac
gatgagccgcgtgatagggagttgtttgagaacagttcgatgtcgcaacaacccacggtc
agtgaccgcctacgttggttgttacaaacctttaaatatcagaaaaatatccacattcac
tcttttgatgagcacgggattgagccttatcctcacggttgggatgtgtggagccgtggc
gtaaaagctttcatgaatgaaaagggtattgtccccagctttatctattccagcgagagt
caggatgcgccgcgttaccgggagcaactgggaattgaaaccattttgattgacccgcag
cgctcatttatgaacatcagtggccgccagatccgccgcgatcctttccgctattgggat
tatatcccgactgaagtcaaacccttctttgtgcgcacggtagccatcctcggtggcgaa
tccagtggtaaatcgacgctggttaacaagttagccaatatcttcaataccaccagtgcg
tgggaatatggccgtgagtatgtcttctcccatctggggggcgatgagatggcactgcaa
tattcggactatgacaaaattgcgctggggcaggcgcagtatgtggattttgcggtgaaa
tacgccaataaagtggcgtttattgatactgatttcgtcaccacacaggcattttgtaag
aaatatgaagggcgggaacaccccttcgttcaggctctgattgatgaataccgttttgat
ctggtgatcttattggaaaataataccccgtgggtggcagatgggttgcgtagcctcggt
agtgaccgcgatcgaaaatccttccaaaatttactcgagcagatgttgcgcgacaataat
attgaatacgttcatgtcgagtcagccgattatgacgcccgcttcctacgctgcgtcgaa
ctggttcagcaactgctggccgccgatccgcaacggcttgcccgcccttcagtattaacg
gatgcgcgataa

DBGET integrated database retrieval system