KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB0644
Entry
YPTB0644          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Brite
KEGG Orthology (KO) [BR:yps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB0644
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB0644
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: CAH19884
UniProt: Q66EP8
Position
763050..763493
AA seq 147 aa
MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSARLKLKKYPHCEASVLNY
GLPSLSQQVPVITDLLELARHIQRIIATFESRLDPRSIKVVPLINKGETWVLAILFDIHA
RCNLPGEEHLVNLRIALDYSYGMVRVL
NT seq 444 nt   +upstreamnt  +downstreamnt
atggatatttcagcaccgatactttttgacaaattaagtctccgccatgaacacgttcgc
ttacctcattggcgtgaagtgattgtgcgcgatattgaatctttattgaatgactccgca
cacagtgcccggttgaagctaaaaaagtatccgcattgtgaggcttccgtattgaattac
ggcctgccttcgctcagccagcaggttccggtaatcaccgacttgctggaactggccaga
catatacagcggatcatcgccacgtttgagtcacgcctggatccgcgctcaataaaagtg
gtgccgctgattaataaaggcgaaacctgggtgttagccatcctgtttgacattcatgcc
cggtgcaacctaccgggcgaagagcacttggtcaatttacgcatcgcgctcgattactcc
tatggaatggttcgcgttctttaa

DBGET integrated database retrieval system