KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB1011Help
Entry
YPTB1011          CDS       T00195                                 

Gene name
manC
Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00051  Fructose and mannose metabolism
yps00520  Amino sugar and nucleotide sugar metabolism
yps01100  Metabolic pathways
yps01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    YPTB1011 (manC)
   00520 Amino sugar and nucleotide sugar metabolism
    YPTB1011 (manC)
Enzymes [BR:yps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     YPTB1011 (manC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 Peptidase_M10 IspD
Motif
Other DBs
NCBI-ProteinID: CAH20251
UniProt: Q66DN2
Position
1213743..1215149
Genome map
AA seq 468 aa AA seqDB search
MLLPVIMAGGAGSRLWPLSRALYPKQFLALTSDLTMLQETLLRLDGLPHLAPLVICNEEH
RFIIAEQLRQKNLVHSGIVLEPVGRNTAPAIALAALRATMSGDDPLLLVLAADHVIQDKL
AFIRAVQRAEPLAEAGKLVTFGIVPKSPETGYGYIRQGKQVVDGAYQVAAFVEKPDLITA
ERYLASGDYYWNSGMFVFKASRYLQELDLHRPDILAACKQAIAGQHTDLDFIRLNEEAFS
SCPDESIDYAVMEKTSDAVVVPLDAQWNDVGCWSALWEINTKDDHGNVIRGDVLIEDTNN
SYVYSQNRLIATVGINDLVIVETKDAILVAHKDKVQNVKGIVGQLKLESRCEYLQHREVY
RPWGSHDAIAEGVRYHVQHVTVKPGQRIATQIHYHRAEHWIVVSGIAKVHYGKETYLVNE
NESTYIPVGIAHSIENPGQIPLEIIEVHTGNYISEDDVERIDDLGVGY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgctattacctgtaattatggctggaggtgctggtagccgtttgtggccattatcccga
gctctttatcctaaacaatttctagcgctaacgtcagatttgacgatgctacaagaaacc
ctattgcgtctggacggtcttccccaccttgcaccattagtgatttgtaacgaagaacat
cgctttattatcgcagaacagttgcgtcagaaaaatctggtgcatagcggaatagtcttg
gaacctgttgggcgcaataccgcgccagctatagcattggctgccttacgagcaacaatg
agtggggatgatcctctattattggtattagcagccgatcacgtgattcaggataaactt
gcatttattcgtgccgtccaacgtgctgaaccgcttgctgaagcgggaaaattggttact
tttggaatcgtgccaaagagtccggaaacaggatatggatatattcgccaagggaagcaa
gtcgtagatggcgcttatcaggttgctgcttttgttgagaagccagatctgattactgca
gagcggtatttggcttcgggtgactattattggaatagcggtatgtttgtatttaaagca
tctcgctatctacaggaattagatctacatcgtccggatattttggctgcctgcaagcaa
gccattgctggtcaacatactgatttagattttattcgtctcaatgaagaagctttctct
agttgccctgatgaatctatcgactatgctgtgatggaaaaaactagcgatgccgttgta
gtgccactggatgcacagtggaatgatgttgggtgctggtcagcgctttgggaaattaat
actaaagatgaccatggtaatgttattcgtggtgatgtattaatagaagatactaataat
agctacgtttattctcaaaataggctcattgcaactgtaggcattaatgatttggttatt
gttgaaactaaagatgccattttagttgctcataaagataaagtacaaaatgttaaaggg
atcgttggacagcttaagcttgaatctcgatgtgaatatctacagcaccgggaagtctat
cgcccttggggttcgcatgatgctattgctgaaggtgttcgctaccatgtccaacatgta
acggtgaaaccaggtcaacgtattgctactcaaattcattatcacagagcggaacattgg
attgtggtttctggcattgccaaagtacattatggaaaagaaacttatttggttaatgag
aatgaatccacttatattcccgtcggcattgctcattctattgaaaatccaggtcagatc
cctctggaaataatagaggttcatactggtaattacatttcagaagatgatgtggaacga
atcgatgatttaggtgtagggtattaa

DBGET integrated database retrieval system