KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB1486
Entry
YPTB1486          CDS       T00195                                 

Definition
(GenBank) putative membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTB1486
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB1486
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB1486
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: CAH20725
UniProt: Q66CC0
Position
1779246..1779932
AA seq 228 aa
MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDA
GHSEQSCQHIRYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRA
VLREPAPDRAVLTCFHRVLMLGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSGGILAS
AASRNRLGIWLRYWPVRLGLAALMVALLWWGLDHWLSGLLTTLLPEPV
NT seq 687 nt   +upstreamnt  +downstreamnt
atgaatcctcacctaaccgaacaccccccagtcggggatattgacgccctgttacaggac
acctggctacaggtgatcagcctgcgtcaaggggtaacctgtgccgagggcgaagggcag
gcattctggcagcgctgtgtggcggacattgaacgtgtccatcaggcgctgaaagacgcc
ggtcacagcgagcagagttgccagcacatccgatacgcccaatgtgcactgctggatgaa
actgtgaaagggcgcggtgtacaggatgatgcctacttcgtgtggtgccattcgccctta
caggcgcattttttcaataccctggatgccggtagccagctttacgagcggatgcgcgcc
gtgttgcgtgagcctgcgccggatcgcgcggtactgacctgttttcaccgggtattaatg
ttgggcttcctcggcgggtacgcctccccggcggcttctgaacgggagcaactgatcgat
caactgagcgtgcaggtaccggcgttcagtgtcgcgccatccggtgggatcctggcaagc
gccgcctcccgcaaccggttggggatctggctgcgttactggccggtacggctcgggctg
gctgcgctgatggtcgcgctgttgtggtggggccttgatcactggctgtccggtctgtta
accaccttactgccggagccggtgtaa

DBGET integrated database retrieval system