KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB1487
Entry
YPTB1487          CDS       T00195                                 

Definition
(GenBank) OmpA family of outer membrane porins
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: CAH20726
UniProt: Q66CB9
Position
1779932..1781668
AA seq 578 aa
MSRWWQRGLWLWAGLLAVILCLAFLPLSPWGRWLMLAWVVLICMLGGSRAGRQAAGASSD
PLFAGLATENGLLPENSRLPVVLVCGDGLASWFGRERSHQSAQGCWLRVDDISTLRQFAR
QLLWQRPEWAAQLAVMMVVNPQQRRDERLLAADLQELRWQLMQLRRDSRHPVPLLLSSTV
ATSVARDTVWLSQQQTPPLTLWSTVSTPGSLADWQRAESRAVQAERLKQAVLFSSQHDWL
NAQVLPVLQAPNADVAPLAPQQIIQQQVASLADPVPASLWQHWLAAHTTLTQVAGWHPPP
PAAHDALPLPDFVFSALPLGSGVSSRRRVLRHGVTLLTLAAMVALCSSAWQNRQLLHRVA
FDIRQYHSVAMTDYSPKAQAVAVLRRDAGLLDEGYRNGEPLRLGLGLYRGERLRPPLLAA
IKSYIPPPPPPPAPPAPKTVRLDSLSLFDVGKFTLNAGSTKMLVTALIDIKAKPGWLIVV
AGHTDITGDAQANHILSLKRAEALRDWMLSTSDVSPTCFAVQGYGATRPIADNDTPDGRA
LNRRVEISLVPQADACQVPDVKTASQDESDVSTQEMEK
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgagtcggtggtggcaacgtgggttgtggctctgggcgggtttgctggcggtcatcttg
tgtctggcatttctgccgctctccccgtgggggcgctggctgatgctggcatgggtggtg
ctgatttgcatgttgggcgggtcgcgggcagggcggcaagcggccggtgcatcctctgat
ccgctgttcgccgggttggcaactgaaaacggtcttctgcctgaaaacagtcgcttaccg
gtggtgttggtatgtggtgatggtctggcgtcatggtttggtcgcgaacggtcacaccag
agtgcacagggctgctggctgcgggtggatgatatcagcaccctgcggcagtttgcccga
caactgctgtggcaacggccggaatgggccgctcagttggcggtgatgatggtcgtgaac
ccgcagcaacgccgcgatgagcgcctgctggccgccgatctgcaagagctgcgctggcaa
ctgatgcaactgcgccgcgatagccgccatccagttcccttgctcctgagcagcacggtg
gccacctcggttgcccgtgatacggtctggctgtcacagcagcagacaccgccgctgaca
ctctggtcaaccgtctcgacgccgggctctctggccgactggcagcgtgcggaaagccgt
gccgtacaggctgaacgactgaaacaggcggtgctgttcagcagccagcatgactggctg
aacgcacaggtgctgccggtattgcaggcacccaatgcggatgttgccccccttgccccg
caacagattattcaacagcaggttgccagtctggccgatccggtgcctgcctcgctgtgg
cagcactggctggcggcgcataccacgctgacacaggtggcgggttggcatccaccgccg
cccgccgcccatgacgccttaccgctgccggattttgtcttttcagcgcttcctcttggt
agcggggtgtcgtcacgccgtcgggtactgcgccatggtgtcaccttactgacgttggcg
gcgatggtggcgttgtgcagcagcgcctggcagaaccggcaactgttgcaccgggtggcc
tttgatatccgtcagtaccacagcgtggcgatgacggattattccccgaaagcgcaggcg
gtggcggtattacgccgtgatgcggggctgcttgatgaagggtaccgcaacggtgaaccg
ctgcgtctgggcctggggttatatcggggggagcggctgcgcccgccgctgttggcggcg
atcaaaagctacatcccgccccctccgccccctcccgcgccaccggcgccgaaaaccgtg
cgcctcgacagcctgtcactgttcgatgtgggtaaattcacgctgaatgcggggtccacc
aaaatgctggtcacggcgctgatcgacatcaaagccaaacccggctggctgatcgtggtg
gccgggcataccgacatcaccggcgatgcgcaggccaaccacattctgtcgcttaagcgc
gccgaagcattacgcgactggatgctgtcaaccagcgacgtctcgccgacctgctttgcg
gtgcaaggttacggggccacacgccctatcgccgacaacgatactcccgacggtcgggcg
ctcaaccgccgggtcgaaatcagtctggtaccacaggctgatgcctgtcaggtgccggat
gtaaaaacagcgtcacaggatgaaagtgacgtatcaacgcaagaaatggagaagtaa

DBGET integrated database retrieval system