KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB1488Help
Entry
YPTB1488          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTB1488
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB1488
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB1488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CAH20727
UniProt: Q66CB8
Position
1781672..1782163
Genome map
AA seq 163 aa AA seqDB search
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFV
FTKEIDASTPYLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHD
VKDPAKEKHNHLELVELRYEKITWTFKDGNIIHSDSWNERATA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcaattccagtttatctgtggctgaaagacgacggcggtgcggacatcaagggttct
gttgatgtgcaaagccgtgaaggcagcattgagatcgtggcacaggaccataacctgtac
atcccaaccgataacaataccggcaaactgaccggtacccgtatccacaccccgttcgtt
ttcaccaaagaaatcgatgcgtcgaccccgtacctgtacaaagcggtgaccaccggtcag
acactgaaaaccgccgagttcaaatggtaccgcattgatgacgctggccaggaagttgaa
tatttcaacaccaaactggaaaacgtcaaagtggttaaagttgcgccgaaaatgcacgac
gtgaaagatccggcgaaagagaagcacaaccacctggaactggtggaactgcgctacgaa
aaaatcacctggacctttaaagacggcaacatcattcattccgattcgtggaacgagcgc
gccaccgcatag

DBGET integrated database retrieval system