KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB1490
Entry
YPTB1490          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTB1490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB1490
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB1490
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1 Adhesin_P1_N
Other DBs
NCBI-ProteinID: CAH20729
UniProt: Q66CB6
Position
1785196..1787694
AA seq 832 aa
MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATML
MQDASLTLAAPVAEAFGVTVQQTQRVIHGVVTGFKRLSASKEECRYELSLQPRLALLSRS
HQNGIYQDMSVPQIVEKILRERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLA
EVGIWFRFTADPKLNIDVVEFYDDQRFYQQGLTLQAVPPSGMHDSGMESVWDLSSAHQVV
EKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYADNYLTAGSEGREPESESGAFY
ARLRHERYLNNQARFAGVANAAALAPGQELNVTGNDVPAQFGKGVIVTRITSHARRDRSY
EVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVNDTYGHIDKDGRYRVNLMFDRD
SWEPGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDH
VTISNYKRNVLRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFE
LRTDSFGVLRAEKGLFITADGQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASP
ANLQVQISLLQQNLTELKQAVLLLSAPKGIALSSGEHLQLSASENLIATAGKNADVSVGK
NFFIGVGNTLSVFVRKLGIKLIANQGAITVQAQNDLMELLARKAITITSTEDEIKITAKK
KITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRQEKAKQVVAMPEFQLIPGGKHNLQF
LFTDDDNVPYSNTPYIAYLVDGREIKGVTDAKGNTEKFVTDEEQNIKINLQV
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgaataccactctcccgactcttcggtttgaccatagccaccacaaactggtggtccgc
gacagcaccgccgccgttgatgtgctgggctttgaaggccacgaaagcctgagccagccg
ttctgttacgacatccaattcaccagcgccgacaaggcgattgacccggccactatgctg
atgcaggacgcgtcactgacattggcggccccggtggccgaagcttttggcgtgacggtt
cagcagacccagcgggtgatccacggggtggtgaccggatttaaacgcctgtcggcctcg
aaagaggaatgccgctacgaactgagcctgcaaccgcgcctggccttgttgtcgcgcagc
catcagaacgggatatatcaggacatgtcggtgccgcagattgtggaaaaaattctgcgt
gagcgccatgacatgcgcggtcaggattttgtcttcacgctggcccgcgagtacccacgc
cgcgagcaggtaatgcaatacggcgaggatgacctgacctttatccgccgcctgctggcc
gaggtggggatctggtttcgttttaccgccgatcccaaactcaatattgatgtggtggag
ttttacgacgaccagcgcttctatcagcaaggactgacgctacaggcggtgccgccttcg
gggatgcacgacagcgggatggaatcggtctgggatttgtccagcgcccatcaggtggtg
gaaaaatcggtcagtaccggtgattacaactaccgcaccgccactgccgatatgaccgcc
ggggccgacatcacgcgcggtgataccaccacctacggcgaagcttatcattacgccgat
aactacctgaccgcaggcagtgaagggcgcgagccggaaagtgaaagcggggccttttat
gcccgtctgcgccatgaacgttacctcaataatcaggcgcgcttcgccggggtggccaat
gcggcggcactggcaccgggtcaggaactgaacgtcaccggcaacgacgtgccagcacag
tttggcaaaggggtgatagtcacccgcatcaccagccacgcccgccgcgaccgcagctat
gaagtgcattttgaggccatcccttactccgaagagtattgcttccgcccgatcctcatc
aacaagccaaaaatggccggcaccttgcccgcacgggtcaccagcaccacggtgaacgac
acttacggacacatcgacaaagacggccgctaccgtgtcaatctgatgtttgaccgggac
agttgggagccgggttacgaaagcttgtgggtccgtcaggcccgcccgtatgcgggtgac
agctacggcctgcacctgccgctgctggcaggcaccgaagtggcgatcgcgtttgaagac
ggcaacccggaccggccgtatatcgcctatgtgctgcacgactcggcgcacggcgaccat
gtcaccatcagcaactacaaacgcaacgtactgcgtactccgtcgaataacaaactgcgc
cttgaggatgaacggggtaaagagcacatcaagctcagcaccgaatatggcggcaaaagc
caactgaatctggggcatttggttgataacgagaaacagcctcggggtgagggttttgag
ctgcgcaccgacagttttggtgtattacgggcagaaaaaggcctctttatcactgccgac
ggacaggccaaagcacaggggcaggtgctggagatgcaaccggctatcagcctgttgaaa
agtgcgcaggaacagatggaggccatctccgcggatgcacaaaccgccaccgccagtccg
gccaacctacaggtacaaatcagtctgttgcagcaaaatctcactgaactgaaacaagct
gtcctgttactgagtgcgccaaaggggatcgcgttgagcagtggcgaacatttacaactg
tcggccagcgaaaatctgatagccactgccggtaagaatgcggatgtcagtgtaggtaag
aatttttttatcggtgtgggcaacacgctgagcgtatttgtacgcaagctggggataaag
ttgatagcgaatcagggagcaataacggtacaggcccagaatgatctgatggagttattg
gcgcgtaaagcgatcacgatcaccagcaccgaggatgagataaaaatcaccgccaagaag
aagataacgctaaatgcaggcggcagttatatcacgctggatgagaatcggatcgagtca
ggaacggcgggggaatatttgaccaaagcagggtattacgggcgacaggaaaaagcgaag
caggtagtggcaatgccagaatttcagctgattcccggtgggaagcataatctacaattt
ctatttaccgatgatgataatgtaccttattcaaatacaccgtatattgcttatcttgtc
gatggaagagaaattaaaggagtgacagatgcaaaaggtaatacggaaaaatttgttacc
gatgaagagcaaaatataaaaataaatttacaggtatag

DBGET integrated database retrieval system