KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB1493
Entry
YPTB1493          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTB1493
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB1493
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB1493
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1 CENP-F_leu_zip Adhesin_P1_N
Other DBs
NCBI-ProteinID: CAH20732
UniProt: Q66CB3
Position
1789798..1792500
AA seq 900 aa
MNTSLPAIRFDHSHHKLVVRDSTAPVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATML
MQDASLTLAAPVAEAFGVTVQQTQRVIHGVVTGFKRLSASKDECRYELSLQPRLALLSRS
HQNGIYQDMSVPQIVEKILRERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFISRLLA
DVGLWFRFTADPKLNIDVVEFYDDQRFYPPGLTLQAVPPSGMHDSGVESVWDLSSAHQVV
EKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYADNYLIAGSEEREPESESGAFY
ARLRHERYLNNQARFSGVANAATLGPSQELKVTGNDVPAQFGKGVIIIRITSYARRDRSY
EVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWEPGYESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDH
VTISNYKRNVLRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFE
LRTDSFGALRAEKGLFISADGQAKAQGQVLEMQPAISLLQGAQEQMDAISADAQTATASP
ADLQAQISLLQQNLSELKQAVVLLSAPKGIALSSGEHLQMSASENLIATAGKNTDISVAK
NLFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELLARKAITITSTENEIKITAKK
RITLNAGGSYITLDENRIESGTAGEYITKAGHYERQEKASLKSIIPAFPIIEPGEHSLRF
AFYGDDNVIGSMGHLVGQPYNIRNSAGEVIASGVLDQSGRFPRVKTQEADELTLTLGEEK
WTVEELIASTEDPIGEEFSEPDEYDVDSDPYFENIAQEQQSNRLPDTIINKFIGYVEEDI
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgaatacctctctccccgctattcggtttgaccatagccatcacaaactggtggtccgc
gacagcacggctcccgtcgatgtgctgggttttgaaggccacgaaagcttaagtcagccg
ttctgttacgacattcaatttaccagcgcagacaaggcgattgacccggccacgatgctg
atgcaggacgcgtcactgacattggcggccccggtggccgaagcctttggcgtgacggtt
cagcagacccagcgggtgatccacggcgtggtgaccggatttaaacgcctgtctgcttca
aaagatgaatgccgttacgaactgagcctgcaaccgcgtttggctttgttgtcgcgtagc
catcagaacgggatttatcaggacatgtcggtgccgcagattgtggaaaaaattctgcgt
gagcgccatgacatgcgcggtcaggattttgtcttcacgctggcccgcgagtacccccgc
cgtgagcaggtgatgcagtacggcgaagatgacctgacctttatcagccgcctgctggcg
gatgtggggctctggtttcgttttaccgctgaccccaaactcaatattgatgtggtggag
ttttacgacgaccaacgtttttacccgccagggctgacgctacaagcggtgccaccttcg
gggatgcacgacagcggcgtggagtcggtctgggacttgtccagtgctcatcaggtggtt
gaaaaatctgtcagtaccggcgattacaactaccgcaccgccactgccgatatgacggcc
ggggcagacatcactcgcggtgataccaccacctacggcgaagcttatcattacgccgat
aactacctgatcgcaggcagcgaagagcgtgagccggaaagtgaaagtggggcgttttat
gcccgcctgcgccatgaacgttacctgaacaatcaggcgcgcttttcgggggtagccaat
gcggcgacactggggccgagtcaggaactgaaagtcaccggaaacgatgtgccggcacag
tttggtaaaggggtgataatcatccgcatcaccagctatgcccgccgtgaccgcagctat
gaagtgcattttgaggctatcccttactccgaagattattgcttccgtccagcacttatc
cgcaagccgaccatggccgggaccttgccggcgcgggtgaccagtaccactgcgaacgac
acctatggtcatatcgacaaagacgggcgttaccgtgtcaatctgatgttcgaccgtgac
agttgggagccgggttacgaaagcctttgggttcgtcaggcccgcccgtatgcgggtgac
acctacggcctgcacctgccactgctggcgggcaccgaagtggcgattgcgtttgaggat
ggcaacccggaccggccctatattgcttatgtgttgcacgactcggcgcacggcgaccat
gtcaccatcagtaattacaaacgcaacgtacttcgcactccgtcgaataacaaactgcgc
cttgaagatgaacggggcaaagagcacatcaagctcagcaccgaatacggcggcaaaagc
cagttgaatctggggcatttggttgataacgagaaacagccacggggtgaaggttttgag
ctgcgtaccgacagttttggtgcattgcgtgcagaaaagggcctctttatcagtgccgac
ggtcaggccaaagcccaggggcaggtgctggagatgcaaccggctattagcctgttgcaa
ggtgctcaggaacagatggatgccatctccgcggatgcacaaaccgccaccgccagtccg
gccgacctgcaggcacaaatcagtttgttgcagcaaaatctgagtgagctgaaacaagcc
gtggtattgctgagtgcgccaaaaggcattgccttgagcagtggtgagcatctgcaaatg
tccgccagcgaaaatctgatagccactgccggtaagaataccgacatcagcgtagcaaag
aacttatttattggtgtgggaaataccttaagtatcttcgtcagaaaactggggatgaag
ctgatagccaatcaggggccgataacagtccaggcgcagaatgatctgatggagttattg
gcgcgcaaggcgataacgatcaccagtaccgagaatgagataaaaatcaccgccaagaag
aggattacgctgaatgcgggcggcagttatatcacgctggatgagaatcggattgagtca
ggcacggctggtgaatatataaccaaagcagggcattacgagcggcaggaaaaggcgagt
ttaaaatctataatacctgcttttcctattattgaaccgggagaacatagtttacggttt
gcattctatggtgacgataatgttattgggtctatgggacatcttgtcgggcagccttac
aatatccgtaatagcgctggtgaagttatagcttcaggagtattggatcaatctggccgt
ttcccaagagtaaaaactcaagaagcggatgagttaacgctgactttaggtgaggaaaaa
tggacagtagaagagcttatagcgtcaacagaagatcctatcggtgaggagtttagcgaa
cctgatgaatacgatgtagatagtgatccttatttcgaaaatatcgctcaagaacaacaa
agtaatagattgcctgatacaataattaataaatttattggctatgtagaagaggatatc
tag

DBGET integrated database retrieval system