KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB1498
Entry
YPTB1498          CDS       T00195                                 

Definition
(GenBank) putative membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTB1498
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB1498
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB1498
SSDB
Motif
Pfam: IcmF-related IcmF_C T3SS_needle_reg DUF2271 Phage_holin_3_6 DUF4131
Other DBs
NCBI-ProteinID: CAH20737
UniProt: Q66CA8
Position
1797202..1800624
AA seq 1140 aa
MKRIALPIKKPEVWFWIVALLFLLAGAVLCWLVWQHPERVGLIPGTPQRDRWLTGLVVGT
GILTLCALLSYAGTRLSGRKHFDELRQQAQGDDAPLPEDNAQAGETSQGEPSRLKTRLRR
RYGLFWRDKVRLLMVVGEPDEIAALAPQLAEQGWLEGQRTVLIHGGSLQRPADETGLSEW
RKLRRGRPLDGIVWAMTAAQSGTPQWMDNGLRTLEKMGAALRYQPPVYLWQVCDSDWPQD
SRTEQPVGAVFPAKATPEKVEQQLRALLPQLREQGMQQLSIEPHHDFLLRLAQSLDQGDA
ARWRQRLTPWFTEYAARIPLRGLMFSLPDTSASAAQVHEKSWTVPASWQGVLDDCRVARG
RRVGLPWEQTLCYSLLALIVLWGVGSVVSFTVNRHQMVSAAQQAQQLAQSHAVSDQQLMA
LQALRNDIGRLQARVAQGAPWYQRFGLDHNAPLLEVLMPWYGQANNRILRDATAQSLYQK
LSELAELPANSPQRAARAKTGYDQLKAYLMMARPEKADAVFYAQVMQTTEPTRAGVSPGL
WQSLAPDLWQFYAQNLPAQPDWKITADTGLISQVRQVLLGQMGQRNAESTLYENMLLSVR
RNYADMTLMDMTGDTDAQRLFQTSESVPGMFTRKAWDEQIQQAIDKTVASRREEIDWVLS
DNRRAISEDISPEALKKRLTERYFTDFAGSWLSFLNSLHWNEAHNLSDVIDQLTLMSDVR
QSPLIALMNTLAWQGQTGQQNQALSDSLVKSAKALMNKDQAPAIDQSAGGPVGPLDETFG
PLLALMGKGDAQNRLSSDSSLSLQTLLTRVTRVRLKLQQVVNASDPQEMTQVLAQTVFQG
KSVDLTDTQEYGSLIAASLGEEWSSFGQTMFVQPLTQAWETVLQPSSASLNDQWKNAVVA
NWKSAFDGRYPFAASKSDASLPMLAEFIRKDSGRIDSFLTRELGGVLHKEGTRWVPNKVN
SQGLTFNPAFLAAINQLSQISDILFTDGSQGLRFELLARPVPNVVETNLAIDGQKLHYFN
QMESWQSFRWPGETYKPGTMLTWTGVSSGARLYGDYQGTWGLIRWLEQAKQKKLDEGRYQ
LTFTTADKQPLQWILRTELGKGPLGLLQLRNFTLPAQVFLIQHAPLAIADMSDDEDMAED
NT seq 3423 nt   +upstreamnt  +downstreamnt
gtgaagcgcattgccctaccgattaaaaagccagaagtctggttctggattgttgccctg
ctgtttttgctggccggtgccgtgttgtgctggctggtctggcaacaccccgaacgggtg
gggttaattccggggacaccgcaacgtgaccgttggctgacgggactggtggtgggaacg
gggatcctgaccttgtgcgcattactgtcgtatgcggggacccgtttatccggcagaaaa
cactttgatgagctacggcagcaggcacagggcgatgatgcgccgttgccggaagacaac
gcgcaggcaggagaaacgtcgcagggtgaaccgtcccgcctaaaaacccgcctgcgccgc
cgttacggtctgttctggcgcgacaaagtccggctgctgatggtggtgggtgaacctgac
gaaatcgccgcgctggccccgcaactggcggagcagggctggctggaagggcagcgcacg
gtgcttattcacggcggcagtttacaacgtccggcggatgaaaccgggctgagcgaatgg
cgaaaattgcgccgtggccgcccgttggatggcattgtctgggcgatgaccgccgcgcag
agtggcacgccacagtggatggataacggcctgcgaacgctggaaaaaatgggtgccgcc
ttgcgctatcaaccgccggtgtatctgtggcaggtctgtgacagcgactggcctcaggat
tcgcggacggagcagccggtcggggcggtgttcccggcgaaggctacgccagaaaaggtg
gagcagcaactgcgtgccctgttgcctcagttacgtgaacagggaatgcagcagctttcc
atcgagccgcaccatgatttcttgttgcgtctggcgcagtcactggatcagggcgatgcg
gctcgctggcggcagcgtctgacgccgtggtttaccgagtatgccgcgcgtattcccctg
cgtgggctgatgttcagtttacccgatacctctgcatcggcggcgcaggtacatgagaaa
agctggacggtaccggccagttggcagggggtactggatgattgccgggtggcgcgtgga
cgccgtgtcgggctgccgtgggagcagacactgtgctacagcttgctggcactgattgtc
ttgtggggtgtgggcagcgtggtgtcatttacggtcaaccgccaccagatggtctctgcc
gcacaacaagcacagcaactggcgcagtcgcacgcagtatccgaccagcaactgatggcc
ttacaagccctgcgaaatgatatcgggcgcttacaggcccgcgtggcgcagggcgcgccg
tggtatcagcgctttggtctggaccataatgcgccgctgcttgaggtcctgatgccgtgg
tatggtcaggccaacaaccgtattctcagggatgccaccgcgcagagcctgtatcagaaa
ctcagcgaactggcggagctgcccgccaacagcccgcaacgggcagcacgggcaaaaaca
ggctatgaccagttaaaggcttatctgatgatggcccgcccggaaaaagccgatgctgta
ttttatgctcaggtgatgcagaccaccgagcctacacgggccggtgtctcccccggtctg
tggcagagtctggcgcccgacttgtggcagttttatgcacaaaatctgcccgctcagccg
gactggaaaattaccgcggataccgggttgatcagccaggtgcggcaggtgttgctgggg
cagatgggtcagcgcaatgcagaaagtacgctgtatgaaaacatgctgctgtcggtgcgc
cgcaactatgccgacatgacgctgatggacatgaccggcgataccgatgctcagcgtctg
tttcagacctcggaatccgtgcccggtatgttcacccgcaaggcctgggatgagcaaatc
cagcaggcgatagataaaacggtggcctcccgccgcgaagaaattgactgggtattgagt
gataaccgccgggcgatatccgaagatatctcaccggaagcgctgaaaaaacgcctgacc
gaacgttatttcaccgattttgctggcagttggctgagtttccttaacagtttgcactgg
aatgaggcgcataacctgtcggatgtgattgaccaactgaccttgatgagtgatgtacgc
cagtcgccgctgattgcgctaatgaacacgctggcgtggcaagggcagaccgggcagcag
aatcaggcattatcggattcgctggtgaagtctgccaaggcgctgatgaataaagaccag
gctccggcgattgaccagagtgccggtgggccagtagggccactggacgagacctttggc
ccgttgctggcactgatgggcaaaggcgatgcacaaaacaggctgtcgtcggacagctcg
ctgagcctgcaaacgttgctcacccgcgtgacccgggtgcggcttaaactccagcaggtg
gtcaatgcttcggacccgcaggagatgacacaggtgctggcccagaccgtttttcagggc
aaaagtgttgatctgacggacacgcaggagtacggcagcctgatagccgccagtctggga
gaggagtggagcagcttcgggcagacgatgtttgtgcagccgctgacgcaggcgtgggaa
accgtgctgcaaccttcatcggccagtctcaacgaccagtggaaaaacgcggtggtggcc
aactggaaatcggcctttgatggccgctatccgtttgccgccagtaaaagtgatgcttca
ttgccgatgctggccgagtttatccgcaaggacagcgggcgcatcgacagcttcctgacc
cgtgaactgggcggcgtgctgcacaaagaaggaacgcgctgggtgccgaataaggtgaac
agccaggggctgacctttaacccggccttcctggcggcgattaatcaactgagccaaatc
tccgacatcttgttcactgacggcagtcaggggctgcgctttgagctgctggcccgtccg
gtgccgaatgtggtggaaacgaatctggcgattgacggacagaaattgcattatttcaac
cagatggagagctggcagagtttccgctggccgggggagacctacaaacccggcacgatg
ttgacctggactggtgtgagttcaggcgcccggttgtacggtgattatcaggggacatgg
gggctgatccgttggctggagcaggcaaaacagaaaaagctggatgaagggcgctatcaa
ctgaccttcaccaccgcagataaacagccattgcaatggatattacgcaccgagctgggc
aaaggcccgttaggcctgttgcaactgcgtaatttcactctgcctgcgcaagtttttctg
atacagcacgcgccgcttgcgattgctgacatgtcagacgatgaagacatggcagaagac
tga

DBGET integrated database retrieval system