KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB1499
Entry
YPTB1499          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Brite
KEGG Orthology (KO) [BR:yps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB1499
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB1499
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: CAH20738
UniProt: Q66CA7
Position
1800668..1802269
AA seq 533 aa
MATLTTLLTACAAEPEPLLQQARQQVALWERWLQPVTPDKHTGEDPGYDDHFQQMREEVN
KLSGADTTLTCELAEKLFTTHGKDVRVATYYVWARLHRDGEAGLADGLSLLAGLITRFGE
GLHPLRATSRKTALEWLAGSRMRDSLSLYPEVDKADFERIVGALALIEQGLSLWDEGVRP
QLGGLYTALENRLVQSGGLNAVVPQNSSGSSSAGSLNPANTASPALRPVQSGRDLLDQTK
TLAKYLRNQPQGWLSGHHLIKSVRWDTVHQSPPLDVNGRTRLVPPRPEYRVQLKRLYLQQ
NWLALLEQAESIFAEGVNHFWLDVQWYLHQALSKAGAPFDGWASCITQDLRLLLTRLPGL
EGLCWSDGTPFADEVTLGWINQQVLESVSGWGSEPAAVSSGEDGILLLEPEALAQADSEG
IEAALHWLQSRPGIITARHQWLLRLVMARVAEQYGKNDMALHLLSDLDSSGALLTLPQWE
PGLVFEVKARRLKLLRMKAQRGDSDKTRLHAEMESLLSGLIALDPARAAVLCG
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcgacgttaactaccttgctcaccgcttgtgccgcagagcctgagccacttttacag
caggccagacaacaggttgcgctctgggaacgttggttgcaaccggtgacacccgataag
cataccggtgaagaccccggttacgatgaccacttccaacagatgcgtgaagaggtcaat
aagctctcgggtgccgataccacgctgacctgcgagctggctgaaaagctgttcaccaca
cacggcaaggatgtgcgggtggcaacctattacgtctgggcgcggttgcaccgtgacggc
gaggccgggctggcggatggcctttccctgctggccgggctgatcacgcgctttggtgag
ggcctgcatccgctgcgtgcaaccagccggaaaaccgcgttggagtggctggccggttcc
cggatgcgcgacagcttgtcactttacccggaagtggataaagccgattttgagcgtatc
gtgggcgcactggcccttatcgaacaggggctcagtctctgggacgaaggtgtccggccg
caactgggcgggttgtataccgccctggaaaaccgcctcgtgcaatctggtgggctaaat
gccgtggtgccgcaaaacagcagcgggtcatcatcggcaggcagcttgaacccagccaac
acggcgtcaccggcgttgcggccagtgcaatcgggacgtgacctgctcgatcagaccaaa
acgctggcaaaatacctgcgcaaccagccgcagggctggctctccgggcatcatcttatc
aaaagcgtgcgctgggatacggtacatcagtcaccgccattagatgtgaacggacggacc
cggctggtaccgccgcgcccggaatatcgcgtacaactcaagcgcctttatctgcaacaa
aactggctagcgttgctggaacaggccgaatcgatatttgccgaaggggttaaccatttc
tggctcgatgtgcagtggtacctgcatcaggccctcagcaaagcgggggccccattcgat
ggctgggcgagctgtatcacgcaggatttacggttattactgacccggctgccggggctg
gaagggctatgctggagtgacggcacgccatttgccgatgaggtgacgctggggtggata
aaccagcaggtactggagtcggtctcgggctggggcagcgagcctgccgccgtttcatcc
ggtgaggatggcattctgttgctggagccagaagctttggctcaggcggacagcgaaggg
attgaagccgcacttcactggttacagtcgcgaccgggtatcatcacggcgcgccatcag
tggctgctgcgtctggtgatggcccgggtggcggagcaatacggtaagaacgatatggcc
ctgcatctgctgagtgaccttgatagcagcggcgcgttgttgaccttgccacagtgggag
ccggggttggtgtttgaagttaaagcccgccgtttgaagctgttgcgtatgaaggcacag
cggggtgacagtgataaaacccgcctgcatgctgaaatggaaagcctgctcagtgggctt
atcgccctcgacccggcccgtgcggccgtattatgcggataa

DBGET integrated database retrieval system