KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB1502
Entry
YPTB1502          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Brite
KEGG Orthology (KO) [BR:yps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB1502
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB1502
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CAH20741
UniProt: Q66CA4
Position
1804036..1805799
AA seq 587 aa
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAGLNLDKAGARDPYVERLFEGFAFLMGRL
REKLDDDLPELTEGLVSLLWPHYLRTIPSLSIVEFTPQWQEMKERMGVSKGFEVLSRPIG
ERETRCRYTTTQDMDLLPLTLRRAGLDSEPDGRSVIRLRFDCSALADWSRINLSRLPLYF
DADAPLACALHEALTLNTAKLWIRLPGQADRQPLDGYFAPLGFGEQDTLWPKADSAFSGY
QLLLEYFTFREKFMFVALQGLDGIELPAELPWFEIDVVLEKRWQHDFSFSEKNLRLHCVP
VINLFPLESDPLSLSSLQTEYLLRPMRIQDGYTEVYSVDSVISSRHTGHQVYVPFTSFRH
KGGMLRHDAPEYYYHTRVKRGPSGLHDTWLVLGGEAFDNHSVPDNENLSLSLTGTNGQLP
RKALQSTVLDTAVKSTGAQVRVRNLSAPSLPCYPPNRDRFHWRVLSHLGSSFLWMMDNAE
VLRGTLALYDWTDNEMNRRRLEAIAEVKHSEIERFERGYLLRGVHIEITLDSNGFTGTGD
ICLFGEMLSRFFALYTDIHLFNRLTLILQPTGERLEWEENHQSRLPG
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggacgacttaaccctgcgttattttgacgctgaaatgcgctacctgcgtgaagcgggc
gaagagtttgcccgcgcgcaccctgatcgggctgccggattaaatctggataaagccggg
gcgcgtgacccctatgtcgaacgcctatttgaaggctttgcctttctgatgggccgactg
cgggaaaaactggatgacgacctgccggaactgaccgaagggttggtcagcctgctgtgg
ccgcactacctgcgtaccattccgtcgctttctattgtggagttcaccccacaatggcag
gagatgaaagagcgcatgggggtgagtaaaggttttgaagtgctgtcccgccccattggt
gaacgtgaaacccgctgccgctataccaccacgcaagatatggacctgctcccgctgacc
ctgcgccgtgccgggctggacagtgaacccgatggccggtcggttatccggctgcgcttt
gattgcagcgcgctggccgactggagccgtatcaacctgagccgcctgccgctctatttt
gatgccgatgcgccgctggcctgcgccctgcatgaggcgctgaccctgaataccgccaaa
ctctggatccgtttgccggggcaggctgatcgccagccgctggacggctatttcgcgccg
ctggggttcggggagcaggatacactgtggccgaaggccgacagtgcgttcagtggttat
cagctcttgctggagtactttaccttccgcgaaaagtttatgtttgtcgcgttgcagggg
ctggatgggatcgagctgccggcggaactgccgtggtttgagattgatgtggtgctggaa
aaacgctggcaacatgatttttcgttctccgaaaagaacctgcgcctgcattgtgtgccg
gtgattaacctgttcccgctggaatcggacccactgtcgctctcttcattacagaccgaa
tacctgctgcgcccaatgcgcattcaggacggttataccgaagtgtattcggtggactcg
gtgatctcctcccgtcataccgggcatcaggtctatgtcccgttcaccagctttcgccac
aagggggggatgttgcgccatgatgcgccggagtattactaccatacgcgggtcaaacgc
gggccttcggggttacacgatacctggctggtgctggggggcgaggcgtttgataaccac
agcgtaccggataatgaaaatttgtcgctgagcctgaccggcaccaacgggcagttaccg
cgtaaagcgctgcaaagcacggtgctggatacggcggtgaaatccaccggggctcaggtg
cgggtacgtaatctctccgcgccgtcattgccatgctacccgccgaaccgcgaccgtttt
cactggcgggtactgagccatctgggcagcagttttctgtggatgatggataacgccgaa
gtgctgcgcggcacgctggcgctgtatgactggacggacaacgaaatgaaccgccgtcgg
ttggaggcgatcgccgaggtcaaacacagcgagattgaacgctttgagcggggctatttg
ctgcgcggggtgcacattgaaatcaccctcgacagcaacggctttaccggtaccggcgat
atttgtctgtttggggaaatgctcagtcgcttctttgccctgtataccgatattcacctg
tttaatcgtctgactctgatactgcaaccgacaggagaacgtttggaatgggaagagaat
catcagtcccgccttcccggctaa

DBGET integrated database retrieval system