KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB1504
Entry
YPTB1504          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTB1504
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB1504
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB1504
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: CAH20743
UniProt: Q66CA2
Position
1806724..1807425
AA seq 233 aa
MTRRCQTIYLNILPWRWATTVGWLHSNIKKETDVLTTVWKNKTCTSKNKTCTSKHKSWAA
WKNKICIPALVLLLSGCGLTQAVTDSTVSATKSLFYKQIKVLHLDFTAREALNTDAHEAN
SSSEPVMVRVYQLRDDKTFLKTVYQQLASDGEAALKDDLLASRSVVVKPGGAVTLDMPME
KETQFVAVVALFRHPDMAKDHWRLILTLDDLHPDKPRTLELGNNSLTLRAEKK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgacgcgacgctgtcagacgatatacctgaatattttaccgtggcgctgggccactacc
gtgggctggctccacagcaacatcaagaaggaaaccgacgtgttaactaccgtttggaaa
aataaaacctgtacttcgaaaaataaaacctgtacttcgaaacataaaagctgggccgcc
tggaaaaataaaatctgcatccccgcactggttttgttgctcagtggctgcgggctgacg
caagccgtgaccgatagcaccgtgtcggccacaaaatcactgttttataagcagataaag
gtgctgcatctggactttaccgcccgtgaagccctgaataccgatgcgcacgaggcgaac
tcgtcatcggagccggtaatggtgcgggtttatcagttacgtgatgataaaaccttcctc
aaaacggtgtatcaacaactggcaagtgacggggaggcggcgcttaaagatgacctgctg
gccagccgtagtgtggtggtgaaaccgggcggggcggtaacactggatatgccgatggaa
aaagagacccagtttgtggcagtggtggcgctgttccgccatccggatatggccaaagac
cactggcgtctgatactcacgctggacgacctgcatcccgataagccccgtacccttgag
ttgggcaataacagcctgacattgcgggcggagaaaaaataa

DBGET integrated database retrieval system