KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB2090
Entry
YPTB2090          CDS       T00195                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00450  Selenocompound metabolism
yps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    YPTB2090 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:yps03016]
    YPTB2090 (selD)
Enzymes [BR:yps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     YPTB2090 (selD)
Transfer RNA biogenesis [BR:yps03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    YPTB2090 (selD)
 Prokaryotic type
    YPTB2090 (selD)
SSDB
Motif
Pfam: AIRS_C AIRS
Other DBs
NCBI-ProteinID: CAH21328
UniProt: Q66AP0
Position
2461262..2462308
AA seq 348 aa
MASPAIRLTQYSHGAGCGCKISPKVLDKILHTEQQKFFDPRLLVGNETRDDAAVYDIGNG
VGIISTTDFFMPIVDDPFDFGRIAATNAISDVYAMGGKPIMAIAILGWPIDKLAPEIAQQ
VIEGGRYVCQQAGISLAGGHSIDAPEPIFGLAVTGIVSTEQVKKNSAAKPGCKLFLTKPL
GIGILTTAEKKSKLRPEHRGLATETMCQLNKPGADFAHIPGVTAMTDVTGFGLLGHLSEI
CQGSGVQAILHYSAIPRLPAVEDYIAEGCVPGGTGRNFDSYGHLIGNMSDLQRQLLCDPQ
TSGGLLLAVLPDAEADVQAIAAQHGMTLSPIGELTSADSRRALIEIVV
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggcatcgccagcgatacgtcttactcaatacagccacggagcgggctgtggttgcaaa
atttcaccaaaagttttggataaaattttgcatactgagcaacaaaagttttttgatccc
cggttgctggtgggcaatgaaacgcgtgatgatgcagcggtttatgatattggtaacggt
gttggcattatcagcacgactgatttttttatgccgatcgttgatgatccttttgatttt
gggcgtattgccgccacaaacgcgatcagcgatgtatatgctatgggcggtaaacccata
atggctattgctattttggggtggcccattgacaaactggcacccgaaatcgcacagcaa
gtgatcgagggtgggcgatatgtttgccagcaagcggggatttctttggcaggcgggcac
tctattgatgcccctgaacccatttttggtttggctgttaccggaattgtcagcactgaa
caggttaagaaaaacagtgctgcaaagccaggatgcaaactgtttttgaccaagccattg
ggcattggcatcttaacgacagccgaaaagaaaagtaaattacggccagaacatcgggga
ttggcaacggaaaccatgtgtcagttgaataagcccggcgctgattttgcgcatattccc
ggtgttaccgccatgaccgatgtcacggggtttggtctgttggggcatttgagtgaaatt
tgtcagggttctggtgtccaggccattctgcattactctgcgatcccacgtttgcctgcc
gttgaagactatattgctgaaggttgtgttccaggggggactgggcgtaatttcgacagt
tatggtcacctgatcggtaatatgtctgatttacaaagacaattactttgtgatcctcaa
acctctggcgggttactgttggcggtcttacctgatgctgaagccgatgtacaggccatt
gccgctcagcacggaatgaccctcagcccaattggtgaattaacctcggcggatagtcgc
cgggcgctgattgagattgtagtgtga

DBGET integrated database retrieval system