KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB2656Help
Entry
YPTB2656          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Brite
KEGG Orthology (KO) [BR:yps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB2656
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   YPTB2656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpE TPR_12 Apyrase TPR_14
Motif
Other DBs
NCBI-ProteinID: CAH21894
UniProt: Q668T1
Position
complement(3133795..3134601)
Genome map
AA seq 268 aa AA seqDB search
MNTTNLTELLKSASLTEMLADVIATIKAKPTDTDTRELLFKLYCIDGSWQKALLQLETLT
QLLPEFTKQAELYKNLILSEKMRDEVLAGKRSPGTLGNDLPEWVALLQQANQLHHDGDHQ
QSEALREQALQQAPESIGESATTGCFAWIADSDGRMGPVCEFISAGGYRWVPFAEIQSLT
VSKPKNITDLIWAPAQVKVKDKVWYGYIPARYPLTPETDNETKLGLKTEWHQPTDSLYIG
AGRKMFITDQGEHALFDIEEIVFEIDCV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaataccacgaatttaactgagttattaaaaagcgcgtctttaaccgaaatgctggcc
gatgtcattgctacgataaaagctaagccaacggataccgatacgcgagaactgttattc
aaactctattgtattgatggttcatggcaaaaagccctattgcagcttgaaacattgaca
cagcttttacctgagttcaccaaacaggctgaactctataaaaatctgatattgagtgag
aaaatgcgtgatgaagtgctggcaggcaaacgcagccctggtacgttgggtaacgacctg
cctgaatgggtagccttgttgcaacaagctaatcaactccaccatgatggcgatcatcag
caaagtgaggccctccgtgaacaggctctgcaacaggcaccggaaagtatcggagagagc
gctacgacaggctgcttcgcttggattgctgacagtgatgggcgtatggggcctgtttgt
gagtttattagcgccggcggttaccgttgggtcccgtttgcagagatacaatcactcact
gtttccaaacctaaaaatattacagacctgatatgggcgccggcacaggttaaagtaaag
gataaagtttggtacggttatatacctgcccgctatccactgacacctgaaacagacaat
gaaactaaactgggtcttaaaacagaatggcatcaaccgactgactcactttatattggg
gcagggcggaaaatgtttatcaccgaccaaggtgagcatgcgctgtttgatattgaagag
attgtatttgagatagattgtgtttga

DBGET integrated database retrieval system