KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB2659
Entry
YPTB2659          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTB2659
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB2659
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB2659
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: CAH21897
UniProt: Q668S8
Position
complement(3135809..3138721)
AA seq 970 aa
MSRTINLSSPAMPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDL
KSLIGKEMTIEMELDGNGLGDVRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFY
LANLTSDFKIYQNKNVVDIIEEVFSDYNFPFEKRLATTYPILDFQVQYGETDFNFLQRLM
EEWGIYWFFEHQDHKQKLILVDHVGAHKRSFSTAYHAIEYLSDEPKAGEEYITQFQTQET
LTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHWPGDYDQPDIGEHLSRVRIEE
RGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVDQLSGGEDAFS
CESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGT
NSESDSCWLRVSQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWD
LPANATQSGMVSRTVGGGLTNYNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADS
VLNVGANRSEVVGANYNQDVLGTSMLAIGAASMLQVGLARSVVVGGAHSLNVVLANATNV
GGANMTNVGGFNGLAVGGAHQTAVGGAATLAAGGPIAIGAGGELILSGDIVKIVGKSKVI
IQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGAIALPLPLPLLPIVVPPVTSP
PDPTVPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAP
PETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAP
PETTAPPETTAPPETTAPPETTAPPETTAPRRKQRHRQKQRHRQKQRHRQKQRHRQRQRH
RRKQRHRQRQRHRQRQRHRRKQRHRRKQRHRRKPRHRQRQRHRQRQRHRRNRREHRQGRR
RHRLDFIDKR
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgtcaaggacaataaatttgagcagcccggctatgccttatctattgggtgagcctgcg
ctggtactgtctaagttggaaggcgaggaagctttttcgactttatattcttatactatt
acggcaaagacaccggctaatccattaattccttggcaagcggcttcaaatgtcgatctc
aaatccttaattggtaaagagatgacgattgaaatggaactggacggcaacggcctgggt
gatgtgagaagtgtaggtaaaggcacgcgtgaaattacggggctggttgagagagccaga
tacattggtcgagatgccaatcaggccatatttgagatcactattaagccttggttctac
ctggctaatttaacctctgactttaaaatttatcaaaataaaaatgtcgttgatattata
gaggaagtgttctcagactataattttccgtttgagaaacggttggctacaacctatccg
atattagattttcaggttcagtacggtgaaaccgactttaatttccttcagcgtttgatg
gaagagtggggtatttactggttctttgagcatcaggatcataaacaaaaattaattctt
gtggatcatgtcggtgcgcataaacgctcgttcagtaccgcctaccatgccattgagtac
ttgtcagatgagcctaaagcgggcgaagagtacatcacacaattccagactcaggaaacc
ttgacgagtgggacctgggtcaccaacgattatgacttcacgaaatcccgtgccgatatt
ctggcaatggacagtaaaccgcgtaaaaccagctttaacgatctcgagatttatcactgg
ccaggggattatgatcagccagatattggtgagcacctttcacgcgtgcgtatcgaagaa
cgtggtgctctgggttcgcgggcggtcggttctggtcaactgcgcgggatagtttgtggt
gctaacttcgagctgaaagggttccccgttgataaagcgaatcgggaatacatgattatc
tccagccgtttgacggtggctgaagttgatcaactgtctggcggtgaggatgcgtttagt
tgcgagagttctttcacggttcagccgacgaccaaaatctatcgtcacccacaggtgaca
ccaaaaccgaaaaccaatgggccgcaaaacgccattattgtggggccaccgggtgaagag
atttggaccgatgaatatggccgcgtaaaagtgcgtttcgtttgggatcgctatggcaca
aacagcgagtcagactcttgctggctacgtgttagccaggcttgggcaggtaacagcttt
ggtgggatctatattccacgcattggtcaggaagtcattgttgactgtattaacggcgat
cctgaccggccaatggtgatgggcagcctttataataacgtgacgcgtcccccttgggac
ctgcctgccaatgcgacgcaaagtggcatggtcagtcgtactgttggcggcgggttaacc
aactataacggcgttcgttttgaagataaatcggggctggagcagtactgggaacaggcc
gagcgcgatatgtcgcgtttgactaaaaataatgaaacgcaaattatcggtgccgattcg
gtcctgaatgttggggccaaccgaagtgaagttgtcggggccaattataaccaagatgtt
cttggcacatcaatgttagccatcggtgcagcctctatgctacaggtgggattggcgcgt
agcgttgtggttggcggagcacattcactgaatgtggttttggcgaatgccaccaatgtg
ggtggcgctaacatgaccaatgtagggggatttaatggccttgcggtggggggagcccat
cagacagctgtaggtggtgctgcgacactggcggccggcggccctattgctattggggcg
ggtggtgagcttatcctcagtggggatatcgtaaaaattgttggtaaaagtaaggttatt
attcagggcggtgaagttcacattaactctgatgattgttgtggtcgtaaaacgggcaat
ggcggcggggcattcggtgcctttgcgagcctggcaggtttattgccgctggcgggtgct
attgccttaccgctaccgttacccttgttgccaatagtggtgccaccagtgacatcgcca
ccggatccaacagtgccaccggatccgacattgccaccagatccaacgttgccaccagat
ccaacgttaccgccggaaacaacggcaccgccggaaaccacggcaccgccggaaacaacg
gcaccgccagaaacaacggcaccgccagagacaacggcaccgccggaaaccacggcaccg
ccagagacaacggcaccgccagagacaacggcaccgccggaaaccacggcaccgccagaa
acaacggcaccgccagagacaacggcaccgccagagacaacggcaccgccggaaacaacg
gcaccgccagaaacaacggcaccgccggaaacaacggcaccgccggaaacaacggcaccg
ccggaaaccacggcaccgccggaaacaacggcaccgccggaaaccacggcaccgccagag
acaacggcaccgccagagacaacggcaccgcgccggaaacaacggcaccgccagaaacaa
cggcaccgccagaaacaacggcaccgccagaaacaacggcaccgccagagacaacggcac
cgccggaaacaacggcaccgccagagacaacggcaccgccagagacaacggcaccgccgg
aaacaacggcaccgccggaaacaacggcaccgccggaaaccacggcaccgccagagacaa
cggcaccgccagagacaacggcaccgccggaaccgacgcgaacaccgccagggacgcaga
cgccaccgccttgattttatagataaaaggtaa

DBGET integrated database retrieval system