KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB2665
Entry
YPTB2665          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Brite
KEGG Orthology (KO) [BR:yps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB2665
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB2665
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: CAH21903
UniProt: Q668S2
Position
complement(3147208..3148710)
AA seq 500 aa
MSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVS
DDAYKSIASIIAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLD
ISKDELRRNMKRYKGVAWDQSPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLA
SIGKVAASAHVPFITGAAPSVLQMESWQELSNPRDLTKIFTQNLEYAAWNSLRQSEDSRY
IGLAMPRFLSRLPYGINTNPVDAFHFEETTDGADHSKYVWSNAAYAMAVNINRSFKEYGW
CTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGFIPLVHRKNT
DYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERD
EMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQL
EGLTVSLRMVAKLPSLKDVA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtccactcaagacgcaaaaactaaacaagctacagtcgccagtgcgacggaatatagc
gattttaatacattactgactaaagaatttaaagcgaagtctgagcagacgatagcagca
gtagaaggtgccgttaaaacgttggctgagcaagcgctggctaattcggtcacggtgtca
gacgatgcttataaaagcattgcttccattattgcagagattgatcgcaagctatcagat
cagattaatttaattttgcaccaccaagaattccagtctctggaaagcgcatggcgtggg
ctacactatttagtcaataacaccgagactgatgagaagttgagattacgtttcctcgac
atctctaaagatgaattacgccgtaacatgaagcgttataaaggtgttgcttgggatcaa
agcccattattcaaaaaaatctatgaagaagaatatggccaactgggtggcgaaccatac
ggttgcctggtagcagactattactttgaccatactgcacctgacgttgacttgttggct
tcaattggcaaagttgccgcgtctgcccacgtgccatttattacaggtgctgcaccgtct
gtgttgcaaatggaatcttggcaagaactgtcaaacccacgtgatttgacgaagatcttc
actcagaatcttgagtatgccgcatggaactcactgcgtcagtctgaagactctcgctat
atcggcctggcgatgccacgtttcttgtcgcgtctgccttatgggattaataccaacccg
gtagatgccttccattttgaagagacgacggatggcgcggatcacagcaaatatgtgtgg
tcaaatgcggcttatgcgatggctgttaacatcaaccgatctttcaaagagtatggctgg
tgtacgctgattcgtggggtggaaagtggtggtgttgttgaaggcctgccatgccatacc
ttcccgacggatgacggcggtattgatatgaaatgcccaacagaaatcgctatttctgac
cgtcgtgaagcggaactggccaagaatggttttattccactggttcacagaaagaatact
gattacgcggcattcattggcgcgcagtccctgcaaaaacctgcagaatattacgattcg
gatgcaacggcgaacgccaacctttccgctcgtctgccatacctgtttgcttgttcacgt
tttgcacattatctgaagtgcatcgtgcgtgacaaaatcggctctttcaaagagcgtgat
gagatgcaacgttggttgaatgactgggtgatgaactatgttgatggtgacccggctaac
tcttctctggaaactaaagcgcgccgtcctttagccgctgctgaagtgattgttgaagaa
gttgaaggtaaccctggttactatcaggctaaattcttcttacgccctcatttccagtta
gaaggtttgacagtctccctgcgtatggttgctaaactgccttcgctgaaagacgtagca
taa

DBGET integrated database retrieval system