KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB2673
Entry
YPTB2673          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Brite
KEGG Orthology (KO) [BR:yps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB2673
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB2673
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: CAH21911
UniProt: Q668R4
Position
3159752..3160777
AA seq 341 aa
MLPDESVHQEKHANLDAWYQESQPWNAGFISMMRANAARNPTLPAPGKAPLPEQEAFRIG
QSAHMTFSPREISHAVMKDGKMDLQLFGLGIWGPNGAMPLQMTELAYTRAELHDHTMTDF
VDLFHHRALSQLYRAWFVSQDTASLDRQSDEKFSFYVGSLAGLDPQELNDTELPVHARLA
SSAHLIREARNPEGLVGALQYYFDVPVRMVEYAEQWIFLEESDQTQLGDGAGAMLLGDGA
ILGNTVLDRQHKFQLILGPLSLQQYLRFSLWGQDLPVLREWVRNFVGFEYAWEVQLLLSA
DEVPMATLDGGHQLGYTSWLARSDTTLDVGGMSFEPEMHHD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgttgcccgatgaatccgttcaccaggaaaaacatgccaatctggacgcctggtatcag
gagtctcagccatggaacgccggttttatcagcatgatgcgggcgaatgccgcccgcaac
cctaccctgccagcgccaggaaaagcgcccttgcctgaacaggaagccttccgcatcggg
caaagtgcgcacatgacgttctctccgcgtgagatatctcatgcggttatgaaagacggg
aaaatggatctgcaactttttggcttagggatttgggggccaaatggtgcgatgccgctt
cagatgaccgaactggcctatacccgtgccgagttgcatgatcatacgatgacggacttc
gtcgacctttttcatcaccgcgcattatcacagctttatcgggcgtggtttgtctctcag
gataccgcctcgctagaccggcagagtgatgaaaaattctccttctatgtcggtagtctg
gccgggctggatcctcaagaacttaatgacaccgaactcccggttcatgcccggttagcc
tcctctgcccatttgattcgtgaagcgcgcaaccccgaagggctcgtgggcgcattgcag
tattactttgacgtccccgtgcggatggtggagtacgccgaacagtggatctttctggaa
gaaagcgaccagacacaattgggtgatggtgccggcgcgatgctcttgggcgacggtgct
attttgggcaataccgttttggatcggcagcataaatttcaactgatcctcggccccctc
agcctgcaacagtacctgcgctttagcctctggggacaagacttaccagtattgcgagag
tgggtacgtaactttgttgggttcgaatacgcctgggaagtccagttgttgttaagcgcc
gatgaggttcccatggcaacactcgatggcggacatcaattgggatacacctcttggtta
gcccgcagtgataccacccttgatgtcggtgggatgagttttgagcctgaaatgcatcac
gattaa

DBGET integrated database retrieval system