KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB2678
Entry
YPTB2678          CDS       T00195                                 

Definition
(GenBank) putative OMPA family outer membrane porin
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
SSDB
Motif
Pfam: OmpA BatA rve
Other DBs
NCBI-ProteinID: CAH21916
UniProt: Q668Q9
Position
3165183..3166865
AA seq 560 aa
MFKVKLNKTLSLLWLAAVGTLLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPKPP
QVPIPVPQETAEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQK
RLTYIAEHHPSAQVLTFFPFLPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQ
LSNERLSHNSDNAYWTGNINLANQQPIEITQALQSLSQRLELQDINHSGFATQRNVMAHN
LFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRHGAWSAWLEKKFGIIPSLAST
LSLPPFPAVINDQKPAIKPRVKTPVIKPIPASRGWLWSVCFAAVLLASHMLNTLWQEKNR
HAQFNQQMVPLDNINDFSAQYLARSITQLTDEGKTLTTCVNTFDVTRWGLSQCQTLLSQI
NRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVEQNKGKKILIVGHS
DNTGSSSMNMTLSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRR
VEVLILPTQDRTRMTEPKPL
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgtttaaggttaaattgaataaaacgctctctctattatggctggctgcggtcggcacc
ctattggtgagtgtgaattttaagggaaatgcgttatggaataacgttattttcattact
ttcctggcgctgatggttcttgccatctggaaacattacgccctcaaacccaaacccccc
caagtgccgattcccgtcccgcaggagacagcagaaccggtagaacaggaaagtacggtt
attttaattctcggtccctatgctgagaaatggtttagtaacccagaatcgccagacagt
acacgtttttccagccatgcggtctggatattaatcacgaatcccgccgcgctgcaaaaa
cgcctcacatatattgctgaacatcatccatccgctcaggtattgacctttttccctttc
ttgccggatgtctatgagaatgcagcggtgatgatgtcaaaactcacggtgtggcagaac
acgttttcaacgttatcactgcgatcccccctcccctgcgtatttgctatttatgcgcag
ttgagtaatgaacgccttagccataattctgataacgcatattggactggaaatattaat
cttgcgaaccagcagcctatcgaaattacgcaagccctacagtcactgagccaaagactt
gagttacaagatatcaatcactcaggatttgcaactcagcgtaatgttatggcccataat
ttatttacctggttgaatgaatcgggggtgacaaaccttctgcaatctattttctcgcgc
acccccttacggctaacagacgtcattttgtcggataatggcaaagggttcatcaggcat
ggtgcctggtcagcctggctggagaaaaagtttggcatcataccgagcttagcctcaacc
ttgtcactgccacctttccctgcggtgatcaatgaccagaagcctgcaataaaaccacgg
gtgaaaacaccggtgataaaacctatccccgcatcccgtgggtggttatggagtgtgtgc
ttcgccgcggtgctattagcctcacatatgctaaacaccctgtggcaagaaaaaaaccgg
catgcgcaatttaaccaacagatggtgccgttggacaatatcaacgatttttctgctcag
tacctggcacgcagcatcacccagttaaccgatgaaggtaaaacattaaccacctgcgtt
aatacatttgatgtgacacgttgggggctgtctcaatgtcagacgttattaagccaaatc
aaccgccggattgaatcctatgaaaatattcctgttttcagttttgcccaaaagctccct
ctgtttgactcaaacagtaccaagctgaaactgaactcacaaaccaatgaaatgatgatg
gagttgttatcactggtcgaacagaataaagggaaaaaaatcttaattgttggccattct
gataacacgggcagttcctccatgaacatgacactttccgaacagcgtgcgctggccctt
cgcgattggttaattaaacgcagtgatatcactgtcgataattttattaccaagggaatg
ggggcttcagaaccggttgcgaccaatcacacggaagcgggtcgagaacaaaacagacgc
gtcgaagtactgatattacccacacaagatagaacaagaatgacggagcctaaaccttta
tga

DBGET integrated database retrieval system