KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB3115
Entry
YPTB3115          CDS       T00195                                 

Name
(GenBank) hypothetical protein
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
SSDB
Other DBs
NCBI-ProteinID: CAH22353
UniProt: Q666X9
Position
complement(3676819..3677076)
AA seq 85 aa
MVANGNVESISLPEVRRLMSGELDRSSASEWAFAIIDDDHIRVSDQVVWKVLQCLGGADL
PITDREYLYEKEDFNCWLNEIDSHE
NT seq 258 nt   +upstreamnt  +downstreamnt
atggtagcaaatggtaacgttgagagcatttcactgccggaggtaaggcgcttaatgtca
ggggaacttgaccgctcaagcgcctctgaatgggcgtttgcaataattgatgatgatcac
attcgagtaagcgatcaggttgtttggaaagtacttcaatgcttggggggagcagattta
ccgataactgacagggagtatttatatgaaaaagaagactttaattgctggctcaacgaa
attgactcacatgagtaa

DBGET integrated database retrieval system