KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB3247
Entry
YPTB3247          CDS       T00195                                 

Definition
(GenBank) Conserved hypothetical protein.
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTB3247
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yps02044]
    YPTB3247
Secretion system [BR:yps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTB3247
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CAH22485
UniProt: Q66CB8
Position
complement(3826135..3826626)
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFV
FTKEIDASTPYLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHD
VKDPAKEKHNHLELVELRYEKITWTFKDGNIIHSDSWNERATA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattccagtttatctgtggctgaaagacgacggcggtgcggacatcaagggttct
gttgatgtgcaaagccgtgaaggcagcattgagatcgtggcacaggaccataacctgtac
atcccaaccgataacaataccggcaaactgaccggtacccgtatccacaccccgttcgtt
ttcaccaaagagatcgatgcgtcgaccccgtacctgtacaaagcggtgaccaccggtcag
acactgaaaaccgccgagttcaaatggtaccgcattgatgacgctggccaggaagttgaa
tatttcaacaccaaactggaaaacgtcaaagtggttaaagttgcgccgaaaatgcacgac
gtgaaagatccggcgaaagagaagcacaaccacctggaactggtggaactgcgctacgaa
aaaatcacctggacctttaaagacggcaacatcattcattccgattcttggaatgagcgc
gccaccgcatag

DBGET integrated database retrieval system