KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB3439Help
Entry
YPTB3439          CDS       T00195                                 

Definition
(GenBank) Putative glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00460  Cyanoamino acid metabolism
yps00500  Starch and sucrose metabolism
yps01100  Metabolic pathways
yps01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPTB3439
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    YPTB3439
Enzymes [BR:yps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     YPTB3439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like DUF11
Motif
Other DBs
NCBI-ProteinID: CAH22677
UniProt: Q665S2
Position
complement(4080787..4082970)
Genome map
AA seq 727 aa AA seqDB search
MSTVYRDATLPIEARIDDLLSQMTLAEKVGQLCQQPMLDYQQHRDDYLAGVRAGRWGSRI
LADTAWAGNAPGENVDPCQLNEIQRAAVEHSRLGIPLLFARDVIYGQATVLPIPLAQAAS
WNPELVQQAYRVIAREAASLGIHWTFAPMLDIARDPRWGRTIETSGEDPWLTAQFAAAVV
KGFQGDDLSAADSLMACAKHFVGYAAVEGGRDYDTTELSDNTLHNVHLPPFQAAIEAGVG
SVMTGFCDLGGTPVTAHGELIRGWLKQQQNFDGLVISDWGSIADLTHFGIAQDALRAAEL
ALQAGVDMAMTHEAYEDKLDQLVLQGRIKEALLDDAVRRVLRAKFRCGLFERPYVDEEWH
KRELRRPEHLALAQRLAEQSIVLLKNRQALLPISRTSVPLTLAVIGPHAHSQRQHLGSWC
LDGDADQVMSIYQSLCAIAGEVKVITEQSCFSDEMIECAHRADIVILCTGESHRRTGEAR
NIAELQLPPGQEELIAAVGRTGKPLVVIQCTGRPLPSPATEQYADALLYGWQCGSEAGKA
IARIIFGEQVPCGKLPMTVPRSTGQIPIYYGRKPLGKMRDYREYQPYKDLADTPLYPFGF
GLSYTRFTYSDLQLSHESLELGASLRVTMTVTNDGAVAGDEVVQCYIRQYVASTTRPQRE
LKGFQRISLQPGESGEVSFTLGVRELAFYGQHRRYAQEPSRISVFVGGDSTTPHQADFTL
FENLYTV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgtttatcgcgatgccactctgcccattgaggctagaattgacgatttgctc
agccagatgacgttggcggagaaagtgggccaactgtgtcaacagccgatgctggactat
cagcaacaccgtgacgactatcttgccggggtacgcgctggccgctggggttcacgcatt
ctggctgataccgcctgggcgggcaatgcgccaggagaaaacgtcgatccgtgccagtta
aatgaaatccaacgtgccgccgtagagcacagccgcctgggtattccgctgttgtttgcc
cgtgacgtgatttacgggcaggcgacggtgctgccgatacccctggcgcaggcggcttcc
tggaaccccgagctggtacagcaggcctaccgcgttatcgcccgcgaggcggcttcgtta
ggtatccactggaccttcgccccgatgctggatattgcgcgcgatccgcgctgggggcga
accatcgaaaccagcggggaagatccctggctcaccgcgcagttcgccgccgctgtcgtc
aaaggatttcaaggggacgatctcagcgccgccgatagcctgatggcttgtgccaagcac
tttgtcggctatgccgccgtggaggggggccgcgactacgataccaccgagctgtccgac
aacacgctgcacaatgtgcatctgccgccattccaagcggcgatagaggcaggcgttggc
tcggtgatgaccggtttttgcgatctcggcggtacgccggtcactgcacatggtgaactg
atacgcggttggctgaaacagcagcagaactttgacggcctggtgatcagcgattggggt
tcgattgcggatctgactcactttggtattgctcaagatgcactgagagcagcagaattg
gcgctgcaggccggtgtcgatatggccatgacccatgaggcctatgaagataagctggat
caactggtgttacaggggcggatcaaggaagcgttgctggatgacgcagtgcgtcgggtg
ctacgcgccaagttccgctgtggcctgtttgagcgcccttatgttgatgaagagtggcat
aagcgcgagctgcgccgtcctgagcatctggctctggcacagcggttggcagagcagtcg
atcgtactgctgaaaaaccggcaggcgctgctgccaatctccagaacatccgtaccgctg
acgctggcggtgatcggcccacacgcccattcgcagcgccagcatcttggctcctggtgt
ctggacggcgacgccgaccaagtgatgtcgatctatcaatccctctgcgctatcgcaggg
gaggttaaggtgatcaccgagcagagttgttttagcgatgagatgatcgaatgtgcccat
cgggccgatatcgttattctctgtaccggcgagagccaccgccgcaccggcgaagcgcgc
aatatcgccgaacttcagctaccgccgggacaggaagagttgatcgctgcggtcgggcgc
accggtaaaccgctggtggtaatccagtgcactggccgcccgttgccatcaccagcaacc
gagcagtacgccgatgcgctgttatatggctggcagtgcggtagtgaagcgggtaaagcg
atcgctcgcattattttcggcgaacaggttccctgtggcaaattgccgatgacggtgcca
cgtagtaccggtcagatcccgatttattatggccgcaagccactgggtaaaatgcgcgac
tatcgtgaatatcagccctataaagatctggcggatacaccgctgtatccctttggtttt
ggcctgagttatacccgatttacctatagcgatttgcagttgagccatgaatcactcgaa
ctgggagcatcgctacgggtgacaatgaccgtcaccaacgatggtgcagtggctggggat
gaggttgtacagtgctatattcgccagtacgtcgccagcaccacgcggccacagcgtgaa
ctgaaaggtttccaacgtatcagcctgcagccgggggaatcgggcgaggtcagcttcacg
ctgggagtgcgcgagctggcattttacggccaacatcgccgctatgcgcaggagccgtcg
cgtatcagcgtatttgtcggtggcgactcaacgacgccacatcaggcggattttacgctg
tttgaaaatctttacactgtttga

DBGET integrated database retrieval system