KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB3762Help
Entry
YPTB3762          CDS       T00195                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase [ATP]
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00010  Glycolysis / Gluconeogenesis
yps00020  Citrate cycle (TCA cycle)
yps00620  Pyruvate metabolism
yps01100  Metabolic pathways
yps01110  Biosynthesis of secondary metabolites
yps01120  Microbial metabolism in diverse environments
yps01130  Biosynthesis of antibiotics
yps01200  Carbon metabolism
Module
yps_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPTB3762 (pckA)
   00020 Citrate cycle (TCA cycle)
    YPTB3762 (pckA)
   00620 Pyruvate metabolism
    YPTB3762 (pckA)
Enzymes [BR:yps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     YPTB3762 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_25
Motif
Other DBs
NCBI-ProteinID: CAH23000
UniProt: Q664K7
Position
4464177..4465796
Genome map
AA seq 539 aa AA seqDB search
MSVKGITPQELAAYGIHNVSEIVYNPSYDLLFEEETKPTLEGYERGTLTTTGAIAVDTGI
FTGRSPKDKYIVRDAITQDTVWWADQGKGKNDNKPLSQEIWSHLKGLVTEQLSGKRLFVV
DTFCGANADTRLQVRFITEVAWQAHFVKNMFIRPSDEELARFEPDFIVMNGAKCTNPQWK
EQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGIASMHCSANVGEKG
DVAIFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDGVFNFEGGCYAKTIKLSEEAEPDIY
HAIKRDALLENVVVLADGTVDFNDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTANQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLSLHPTQY
AEVLVKRMQAVGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGEIDKAETFTLPIFDLA
VPMALPGVNPDILDPRDTYADKAQWQEKAEDLAKRFATNFDKYTDTPAGAALVSAGPKI
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttaaaggaattaccccgcaggagctcgccgcctatggcatccataacgtcagc
gagattgtttacaacccaagctatgatttactgtttgaagaagagaccaaacccacgttg
gaaggatacgaacgtggcacactgacgactaccggcgcaatagcggtagataccggtatt
tttaccgggcgttcacccaaagataaatatattgtccgcgatgctatcactcaggatacc
gtgtggtgggccgatcagggcaaaggtaaaaatgataataagcctctgagccaagagatc
tggagccatttgaaaggtctggtgacggaacaactctctggcaaacgcctctttgttgtc
gatacattctgcggtgctaatgcggatacccgcctgcaagtccgctttatcacagaagtc
gcttggcaggcacacttcgtcaaaaatatgtttatccgtccatcagatgaagaactggct
cggtttgaacctgactttatcgtgatgaacggtgccaaatgcactaacccacaatggaaa
gagcagggcctgaattcagaaaactttgtcgcctttaatctgacagaacgtatgcagttg
attggtggcacgtggtatggcggcgaaatgaagaaagggatgttctcaatgatgaactac
ctgctgccactgaaaggcattgcttcaatgcattgttcagctaacgtcggcgaaaaaggc
gatgttgccatcttcttcggtctgtcgggtaccggtaaaaccactttatctaccgatcca
aaacgcaagttgatcggtgatgatgaacatggctgggatgatgatggcgtctttaacttc
gagggggggtgctacgctaaaaccatcaagttatctgaagaagcagagccagatatttac
cacgccattaaacgcgacgccttgctggaaaacgtggtggtgctagcagacggtaccgtt
gattttaatgacggttctaaaactgaaaacacccgtgtctcttatccgatttaccacatt
gataacattgttaaaccggtgtccaaagcaggccatgcgaccaaggttatcttcctgact
gccgatgcctttggtgtgctccccccagtatctcgtctgaccgcaaaccagacgcaatat
cacttcctctctggctttactgccaaactggcagggacagagcgtggcgtcacggagcca
acaccaaccttctctgcttgctttggtgcggccttcctgtctctgcacccaacgcagtac
gctgaagtgctggttaagcgtatgcaagcggttggcgcacaagcctatctggtcaatacc
ggttggaacgggacaggtaagcgtatttccatcaaggatacccgcgccattattgacgca
atcctaaacggggagattgataaggcagaaacctttacgctgccaatctttgatctggca
gtccctatggcgttacccggtgtgaatcccgatatcctcgatcctcgcgacacctacgcc
gataaagcgcaatggcaagagaaagccgaagatttggcgaaacgctttgcgactaacttt
gataaatacactgatacccctgcgggggccgcgttggttagcgcggggccaaagatctaa

DBGET integrated database retrieval system