KEGG   Yersinia pestis A1122: A1122_02575
Entry
A1122_02575       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypt  Yersinia pestis A1122
Pathway
ypt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A1122_02575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypt02044]
    A1122_02575
Secretion system [BR:ypt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A1122_02575
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AEL71192
Position
complement(567378..567896)
AA seq 172 aa
MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLGGGGGSGKVEMKDFEF
RMVSNKASPKLFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFSNCLVSSFKTVGNMPLG
KGDAVFTDTVLPTDAISLNFARIEVEYKEQQPDGSMGAVIKAGYDLKLNSRI
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcagctttagtcgattactttctccatatcgaaggtgtagatggtgagtctcccgat
cagcagtataacggatggatccaagtacaggcttggcaatgggcggaggagaatgcgggg
cgctgggggctaggtggcggtggtggttctgggaaagtcgaaatgaaggacttcgaattt
cgcatggtgagtaacaaagcatcaccaaaactatttttgatgtgtgccatcggtgaacac
attccgcaggccaagttggtgtgtcgtaaatcaggtcaaggtcaacaagacttcctgatt
gttaccttcagtaactgtctggtgtcctcctttaaaactgtcggcaacatgcctcttggt
aaaggggacgcagtattcaccgacacggtgctgccaacggatgccatcagccttaacttt
gcacgtatcgaagtggaatacaaagagcagcaacctgatggctcgatgggggccgtgatt
aaggctggttacgatctgaaattgaacagccgtatttaa

DBGET integrated database retrieval system