KEGG   Yersinia pestis A1122: A1122_02590
Entry
A1122_02590       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
ypt  Yersinia pestis A1122
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypt02044]
    A1122_02590
Secretion system [BR:ypt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A1122_02590
SSDB
Motif
Pfam: ImpA_N Inhibitor_I48 LptC
Other DBs
NCBI-ProteinID: AEL71195
Position
complement(570141..571154)
AA seq 337 aa
MILKRMDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISE
QANKLLEQCFDLRVMLWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNS
GHAAALGWLSTAQCIAELKTARLTEEHPYILQDLITTEALPNGQERYFVTSSTLFLTVNN
YFQQNGLPDLKDQLTKVDMLLEQIESYANQSTESYQLHCEQLRIFLKNNISQLAQLNAPE
HDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLDRILEYFQHYEPSHPAPIFIR
RTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
NT seq 1014 nt   +upstreamnt  +downstreamnt
ttgattttaaaacggatggacaataatatgagtgacatatttcctcaagcattattcggc
gttgaatatgatccggcctatggcgagattgagtccatcctctctcaattagatgagtct
gcggaccccctttcccgcccgcatgaaccccctcaaataaactggcaccatatcagtgag
caagccaataagctgctagagcaatgttttgatttacgtgtaatgctttggtttataagg
gcaaatattcatataaaaggaatatcggccctctatgatggctttatgcgcattaatgca
caaacccaagatactgatgttgttatctaccctcaatcggaagaaccgccattaaatagt
gggcatgccgccgcattaggttggttatctacagcacaatgtattgcagagcttaagact
gcacgccttacagaagagcacccttacattttacaagatcttattacgactgaagcgtta
cccaatggccaagagagatattttgttacatcttcgacattatttttaactgtcaataat
tatttccaacagaatggattgccagatttaaaagaccaattgacaaaagtagatatgttg
ttggaacaaattgagtcctatgcaaatcaatccacagagagttaccaactgcattgtgaa
caattacgtattttcttaaaaaataatatttctcagcttgcacaattgaatgccccagaa
catgacgatcccgaaactgtttatcaaaaaatagacagtcatgaatctcttgatactcag
tcctttaattcaaatgataagagcattcgctcacggcaagagatcattatgatgctggac
cgtattctagagtactttcaacattatgagcctagtcatccagccccaatattcattcgc
cgtaccaaagagatgataggtatggatttttattccattgttgaagaaattctgcctgaa
gctgtaattacattaaaacagtttaccggaaaaactaacctaccgtttcgatga

DBGET integrated database retrieval system