KEGG   Yersinia pestis A1122: A1122_02630Help
Entry
A1122_02630       CDS       T01831                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ypt  Yersinia pestis A1122
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A1122_02630 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AEL71203
Position
580904..581281
Genome map
AA seq 125 aa AA seqDB search
MIEQPRICVQVHSIYVETQSIPEEERFVFAYTVTVRNLGRSNVQLLGRYWLITNSNGRQT
EVQGEGVIGEQPLILPGNEFQYTSGAVLETPLGTMEGHYEMIDHLGQAFRTVIPVFRLAI
PALIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagccccgtatttgtgtgcaggtacacagtatctatgtggaaacgcaatcg
atacccgaagaggaacgtttcgtcttcgcctataccgttaccgttcgtaatttagggcgt
tcaaacgtgcaactgcttggccgctattggttaattaccaatagcaatggccgccagact
gaagttcagggagaaggggttatcggcgaacaaccacttatcctgccaggtaatgaattt
caatacaccagcggtgccgttctggaaactccgctgggtactatggaaggacattatgaa
atgattgatcaccttggacaggccttccgtactgtaattccggtattccgcttagcgatc
ccagccctgatccactaa

DBGET integrated database retrieval system