KEGG   Yersinia pestis A1122: A1122_05035Help
Entry
A1122_05035       CDS       T01831                                 

Gene name
glnL
Definition
(GenBank) nitrogen regulation protein NR(II)
  KO
K07708  two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC:2.7.13.3]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A1122_05035 (glnL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypt01001]
    A1122_05035 (glnL)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypt02022]
    A1122_05035 (glnL)
Enzymes [BR:ypt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     A1122_05035 (glnL)
Protein kinases [BR:ypt01001]
 Histidine kinases
  NtrC family
   A1122_05035 (glnL)
Two-component system [BR:ypt02022]
 NtrC family
  GlnL-GlnG (nitrogen regulation)
   A1122_05035 (glnL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS PAS_4 PAS_8 PAS_9 DUF1688 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AEL71676
Position
1073154..1074203
Genome map
AA seq 349 aa AA seqDB search
MATGTLPDAGQILNTLINSILLLDDDLAIHYANPAAQQLLAQSSRKLFGTPLPDLLGYFS
LNIVLMRESLQAGQGFTDNEVTLVVDGRAHILSLTAQSLAEGFILLELAPMDNQRRLSQE
QLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLAKALPDPALLEYTQVIIEQADRLRN
LVDRLLGPQRPGQHITQSIHQVAERVCQLVSLEKPDNVTLIRDYDPSLPELAHDPDQIEQ
VLLNITRNALQALGETGGTITLRTRTAFQVTLHGMRYRLAARIDIEDDGPGVPTQLQDTV
FYPMVSGREGGTGLGLSIARNLIDQHSGKIEFNSWPGHTEFSVYLPIRQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaggcacgctgcccgatgctgggcagatcctcaatactctcattaatagcatt
ctgctgttagatgatgatttggctattcattatgccaaccccgcagcccagcaacttctg
gcgcaaagctcccgtaaactttttggtacacctctgcctgatttattaggctatttttca
ctgaatatcgtgttgatgcgagagagtttgcaagccgggcaagggtttactgataacgaa
gtgacattagttgttgatggccgggcacatattttatcgctgaccgcacagtccctagcg
gaagggtttattctgctagaattagccccgatggataatcagcgccggttaagccaagag
caattgcaacacgctcaacaagttgccgcacgtgatttagtgcgcggattggctcacgag
attaaaaacccactcggaggcctacggggcgctgcgcaattattagctaaagcgttaccc
gatccagcgttgctggaatatacccaagtgattattgaacaggcggatcgcctacgtaat
ttagttgatcgcttgttaggcccacagcggcctggccaacatattacacagagtattcat
caggttgctgagcgggtttgccaattagtctcattggaaaaaccagataacgtcacgtta
atccgcgactatgatccaagcctccctgagcttgcccatgatccagaccaaatagaacaa
gtgctgctgaatatcacccgtaacgcattacaggctctcggggagactggcggcacaatt
acacttcgcacccgaaccgctttccaagtgacgctacatggcatgcgctaccgtttagcc
gctcggattgatattgaagatgacggtcccggtgtaccaacgcaattacaagataccgta
ttctatccgatggtcagtggccgcgagggcggtacgggtcttggtttatctatcgcccgt
aatcttatcgatcagcattcgggtaaaattgaatttaacagttggccaggacacaccgag
ttttcggtttacctgcctattcgccagtga

DBGET integrated database retrieval system