KEGG   Yersinia pestis A1122: A1122_07365
Entry
A1122_07365       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
Organism
ypt  Yersinia pestis A1122
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEL72128
Position
1625143..1625886
AA seq 247 aa
MHRGHGREYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLA
EENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLL
SNMSLNYMSLLDKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLP
VRGLQTTLWLEQGAFSSEGELYLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEWPVQ
TGQHALM
NT seq 744 nt   +upstreamnt  +downstreamnt
gtgcaccggggtcatggccgggagtacacctcgtttgagagcttccaccatcagatcgaa
cactcgcaagaaaagaccgcactttattaccgcctacgtgtgaaaaattcattattccgt
aagggattcgaacactacatttcctttgttcgcagtgatgaatcgaagctggtgcttgct
gaagagaatgtctcggtcagcctgacgtgcaccaaccgtgagttgccgctgtcgttgcgc
gttggtgatatcaatcaactcagcacagacagcccttcattcgcgacgttccgcaatatt
acccgtccttccgtgccgttgtatccggtgctggatgggggcctgcattggtcattgctc
tccaatatgtcgttgaactacatgtccttactggataaggacgcgttgaagcaaattctg
catacctatgatttcccaagcctgcataaccggcaatcagccagggcatcgcaaaagaaa
ctggacgctatccaacgtattgaaacacaaccgattgaccggttgtttcgtggcttacct
gtcagagggctacaaaccacgctatggctggagcaaggcgcttttagctctgaaggcgag
ctttatctcttcagcacggtattagctcgcttcttctcactgtatgccagcgtcaatgcg
tttcatcttttaaaagtcatcaatcttgataatcaggaatgttacgaatggccggtacag
acaggtcaacatgcactgatgtaa

DBGET integrated database retrieval system