KEGG   Yersinia pestis A1122: A1122_07390
Entry
A1122_07390       CDS       T01831                                 

Definition
(GenBank) putative membrane protein Aec26
  KO
K11892  type VI secretion system protein ImpK
Organism
ypt  Yersinia pestis A1122
Pathway
ypt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A1122_07390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypt02044]
    A1122_07390
Secretion system [BR:ypt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A1122_07390
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AEL72133
Position
1630274..1631041
AA seq 255 aa
MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLGMVLRLKDMENQALPD
QLYQQVVTDIRAIEQYLQTKGYEPGAIISFRYVLCTFIDETALGHGWNTQNGWLQQSLLV
HFHNETWGGEKVYVLLERLMGEPKRYQDLLEFIYLCFCLGYRGRYKVTSQNGDDFERLFR
RLHHQLQQLRGDAPPTVLYQGGGRLNSRYHLSKRLTIKHLLWGGVSLLVVIYLFYAIHLH
TQSQDILQQLNNLLS
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaaaacagatgctgtgactgacaacacccctttccccgcagcggaagcggtcacctcc
catcggcagtatcagctaccgctacgtggcgaaagcttgaacgcgatgatcgataccgcc
accccattattggggatggtactgcgcctgaaagacatggaaaaccaagcgttaccggac
cagctatatcagcaggtggtgacggatatccgtgctattgagcagtacttgcaaaccaaa
ggctacgaacccggcgcaatcatatctttccgatatgtgctgtgcacattcatcgatgaa
acggcattagggcatggctggaacacccaaaacggttggttacagcaatctctgttggtg
cattttcataatgaaacctggggcggagagaaagtgtacgtcctgctggaacgcttaatg
ggggaacccaagcgttaccaagacctgctggagtttatctatctctgtttttgtttgggt
taccgcggccgctacaaagtgacatcacaaaacggtgatgactttgagcgattgttccgc
cgattgcatcatcaattacagcagttacggggtgatgcgccgccgacggtcctttatcaa
gggggcggtcgtctgaatagccgctaccacttgagtaaacggttgactatcaagcatttg
ttatggggtggcgtgagtctgctggtggtgatttatctgttttatgccatccacctgcac
acccaaagtcaggatattttgcaacagctaaacaatttattgagctag

DBGET integrated database retrieval system