KEGG   Yersinia pestis A1122: A1122_07410Help
Entry
A1122_07410       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
ypt  Yersinia pestis A1122
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypt02044]
    A1122_07410
Secretion system [BR:ypt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A1122_07410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N MafB
Motif
Other DBs
NCBI-ProteinID: AEL72137
Position
1635138..1636526
Genome map
AA seq 462 aa AA seqDB search
MDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGSLAHATLNIDDIQQQA
MALLSQKSKDFRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLFWTTAWPQNPLHKRRFA
QQILKRFDSASSSFSQRADEAQRENVQGLLAHLAQVWHSREPGLAKEVDALRSRYARPPE
RVIEAVASDEPLSSNTLAAAMAATPVSPSLAIDNTSDRAWRQTLLKMADLLSEQQPDAAI
GFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADRTADYLARLANADLPLWHQVEQSLTLA
PYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPALKTLFFTDMTPFLSSESAAWL
QQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQQSEPRDRFYHQLLSAQLFEKA
GLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQRQLKP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggatatcacgtcacaacatccctggcatgtcttgttacaagcccctttgtcacctgag
cagaccgcacaagccctggccgatgatgacccccaatgggaatatatcgacggccagatg
gtgaaactggggtcattggcccacgccacgctgaatattgatgatattcagcaacaagcc
atggcgctgttatcacagaaaagtaaagacttccggctcgtggtgcatctactgcgcacc
ctacaacacgggggccagccagatgaattaatgctggcgatgtcgttgctgaccgaatac
gtccagctattttggactacggcctggccgcaaaatcctttacacaaacggcgctttgct
caacaaatcctaaaacgctttgacagcgccagcagcagttttagccaacgagcggacgag
gctcaacgtgagaatgtgcaaggattattggcacatttagcacaggtttggcatagccgt
gagccgggtctggctaaagaggtggatgcattacgcagccgctatgcgcggccaccggag
cgggttatcgaggcagtggcttctgatgaaccgctctcatccaacaccttggcggcggca
atggccgccacccccgttagcccaagcctcgccatagataacacgagcgacagagcctgg
cggcagaccttgctgaaaatggcggatctactcagcgaacagcaacccgatgccgctatc
ggtttccggctacgccgccatgccgtatggggcgcgttaaccgcaccacctatggcgcag
agcgatggccgcaccccgttagccgcggtatctgcggatcgaaccgccgattacttagca
cgtctggctaatgccgatttgcctttgtggcaccaagtggagcagagcctcaccctcgcg
ccttattggctggatggacatgtgctttcggcacaaatcgccctgcaactgggttatgac
gcggtggcacaggctatccgtgatgaactcagcgtttttttagcccgtattcccgcatta
aaaaccctcttttttacggatatgacgccattcctctcctctgaatctgccgcctggtta
cagcaggatgcgaatcatcagggaagaagtcgcactattgaacaggatgaaatttggcaa
tgctatcaacagcaaggattggaagccgcactacagatgataaaccggcaaccacagcaa
tccgaacctcgggaccgtttttaccatcaattgctcagtgcacagttgttcgaaaaagca
gggttaaccgcattggcgcagcagcactaccacagcttattactggtagggcagcaatta
cagctaagcgaatgggaacctgcgttgatcgctctactgacagaaaaacagcgacaactc
aaaccatga

DBGET integrated database retrieval system