KEGG   Yersinia pestis A1122: A1122_12150Help
Entry
A1122_12150       CDS       T01831                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine transporter subunit
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A1122_12150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypt02000]
    A1122_12150
Enzymes [BR:ypt01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     A1122_12150
Transporters [BR:ypt02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    A1122_12150
   Histidine transporter
    A1122_12150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 ABC_ATPase AAA_16 AAA_23 PRK G-alpha RsgA_GTPase AAA_24 AAA_33 AAA_22
Motif
Other DBs
NCBI-ProteinID: AEL73062
Position
complement(2650232..2651029)
Genome map
AA seq 265 aa AA seqDB search
MTNTSYIKNAETKLSVTELHKHYGEHEVLKGVSLSANAGDVISIIGSSGSGKSTFLRCIN
FLEKPSEGSISVNNQVIRLVRDSDGQLKVFDKKQLQLLRTRLTMVFQHFNLWSHMTVLEN
VMEAPVQVLGLSKSVAKERAILYLDKVGIDERARAKYPVHLSGGQQQRVSIARALAMEPD
VLLFDEPTSALDPELVGEVLRIMQKLAEEGKTMVVVTHEMEFARHVSSHVIFLHKGVIEE
EGPPAELFGNPKSPRLQQFLSGSLK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatacgtcctatattaaaaatgcggaaacaaaactttccgtgacggagctgcat
aagcattatggggagcatgaggtattaaaaggcgtttcgctctctgccaacgcgggggat
gttatttccattattggttcatccggttcagggaaaagtacatttttacgctgcattaac
tttctggaaaaacccagtgaaggatcgataagcgtgaataatcaggttatccgcttggta
cgggatagcgatggtcagttaaaagtcttcgataaaaaacaactgcaattattgcgcacc
cggttaacgatggtcttccaacactttaatctgtggagtcacatgacggtattagaaaac
gtgatggaggcaccggttcaagtgctgggattaagtaaatcggtggcgaaagagcgtgca
attttgtatctggataaagtcggtattgatgaacgggcgcgggccaaatatcccgtacat
ctctctggggggcagcaacagcgtgtttctattgcacgagcactggccatggaaccagat
gtattgctgtttgatgaacccacttcggcgctggatcctgagttggtcggtgaagtgcta
cgtattatgcaaaagttggcggaagaggggaaaactatggtggtggtcacgcacgaaatg
gaatttgcccgccatgtttccagccatgttattttcttacataaaggggtcattgaagag
gaagggccacccgctgagcttttcggtaaccctaaaagcccacgtttacagcagtttctt
tctggctcactgaaataa

DBGET integrated database retrieval system